KEGG   Bacillus subtilis subsp. subtilis 168: BSU36030
Entry
BSU36030          CDS       T00010                                 

Symbol
ywrK
Name
(RefSeq) arsenical pump membrane protein
  KO
K03893  arsenical pump membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36030 (ywrK)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU36030 (ywrK)
SSDB
Motif
Pfam: ArsB CitMHS NADH_dh_m_C1
Other DBs
NCBI-GeneID: 936864
NCBI-ProteinID: NP_391484
Pasteur: BG12527
BSORF: BG12527
UniProt: O05224 A0A6M3ZH22
Position
3712617..3713945
AA seq 442 aa
MLAFFVTMIFIFWRPKGLNEAIPATFGALMVLLCGSVSLADLGEIGTKVTGASVTILATM
IMAIALESFGFFYWVAAKLLQQSKGSGIKLFWLTNLLCFLMTIFLNNDGSILITTPILLL
VLKYLGLKKHQKAPYLLSGVLIATASSAPIGVSNIVNLISLKIIGMDLYLHTAMMFVPSM
MGLIFMTCLLFMFFYKRLPKSLPDIPGHFQSLRHRRYHPLHSPSAPLPERNQTKIMLFVL
AFVFLVRMSLFAASYTGISVPLVAVIGSFILLSWRWIYFKTSPRDLLYKSPWHIFIFAFT
MYVLIYGLHNIGFTELLVSYFEPVVSGSLAHATFASGISTSVFSNLFNNHPALMISTFTL
TEMTLNPSTTKIIYLANIIGSDIGSLLLPMGTLATLIWMHILKQHDESISWGEYIKTTII
IIPLTVLFTLTCLYFWISWLFL
NT seq 1329 nt   +upstreamnt  +downstreamnt
ttgctcgcttttttcgtaacaatgatttttattttctggagaccaaaaggactaaatgaa
gctatccccgccacatttggcgctttaatggttttattgtgcggaagtgtgtcattggca
gacttaggggaaatcggaacaaaagtcacgggtgcatcggttacaatccttgccactatg
attatggccattgcactagaaagctttggtttcttttattgggtggctgcaaaactgctc
caacaatccaagggttcaggcatcaagcttttttggctaaccaatttgctctgctttctc
atgaccattttccttaataatgatgggagcattttgatcacaactccaatccttttgctt
gtactaaaatatttaggtttaaaaaaacatcaaaaagccccatatttattaagcggtgtt
ttaatagccacagcctctagcgcaccgattggcgtaagtaatattgttaatttaatttct
ctcaaaatcattggaatggatctatatcttcacaccgccatgatgtttgtccctagtatg
atgggactcatttttatgacttgtctactgtttatgttcttttataaacgtcttcccaaa
agcctgccagatataccgggccattttcagtctctgcggcatagaaggtaccatcctctt
cattcgccatcagctcctttaccagaacgaaatcaaacaaaaatcatgttgtttgtgctt
gcatttgtttttctcgtcagaatgagtctatttgcagcatcatataccggtatttctgtt
cctctagtcgctgtcatcggatcttttatcctgttgagctggagatggatttatttcaaa
acctccccaagagacttgttatataaatcgccttggcacatttttatattcgcttttact
atgtatgtcttaatttatggtctgcataatattggattcacagagttacttgtgagttat
tttgaacctgtggtttctggaagcctcgcccatgcaactttcgcatcaggtatctctact
tcagttttttctaatctctttaacaaccatccagcgttaatgatcagtacttttacctta
actgaaatgaccctgaatccttcaacaacaaaaatcatctacttggcaaatattatcggc
agtgatatcggttcattattattacctatgggaaccttagcaacgcttatttggatgcat
atattaaaacagcatgatgaaagtatttcatggggcgaatatataaaaacgaccattatc
atcattccgctgactgttctttttacgttaacatgtttatatttttggatcagttggtta
tttctttag

DBGET integrated database retrieval system