KEGG   Bacillus subtilis subsp. subtilis 168: BSU36030Help
Entry
BSU36030          CDS       T00010                                 

Gene name
ywrK
Definition
(RefSeq) arsenical pump membrane protein
  KO
K03893  arsenical pump membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36030 (ywrK)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU36030 (ywrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsB CitMHS
Motif
Other DBs
NCBI-GeneID: 936864
NCBI-ProteinID: NP_391484
Pasteur: BG12527
BSORF: BG12527
UniProt: O05224
Position
3712617..3713945
Genome map
AA seq 442 aa AA seqDB search
MLAFFVTMIFIFWRPKGLNEAIPATFGALMVLLCGSVSLADLGEIGTKVTGASVTILATM
IMAIALESFGFFYWVAAKLLQQSKGSGIKLFWLTNLLCFLMTIFLNNDGSILITTPILLL
VLKYLGLKKHQKAPYLLSGVLIATASSAPIGVSNIVNLISLKIIGMDLYLHTAMMFVPSM
MGLIFMTCLLFMFFYKRLPKSLPDIPGHFQSLRHRRYHPLHSPSAPLPERNQTKIMLFVL
AFVFLVRMSLFAASYTGISVPLVAVIGSFILLSWRWIYFKTSPRDLLYKSPWHIFIFAFT
MYVLIYGLHNIGFTELLVSYFEPVVSGSLAHATFASGISTSVFSNLFNNHPALMISTFTL
TEMTLNPSTTKIIYLANIIGSDIGSLLLPMGTLATLIWMHILKQHDESISWGEYIKTTII
IIPLTVLFTLTCLYFWISWLFL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgcttttttcgtaacaatgatttttattttctggagaccaaaaggactaaatgaa
gctatccccgccacatttggcgctttaatggttttattgtgcggaagtgtgtcattggca
gacttaggggaaatcggaacaaaagtcacgggtgcatcggttacaatccttgccactatg
attatggccattgcactagaaagctttggtttcttttattgggtggctgcaaaactgctc
caacaatccaagggttcaggcatcaagcttttttggctaaccaatttgctctgctttctc
atgaccattttccttaataatgatgggagcattttgatcacaactccaatccttttgctt
gtactaaaatatttaggtttaaaaaaacatcaaaaagccccatatttattaagcggtgtt
ttaatagccacagcctctagcgcaccgattggcgtaagtaatattgttaatttaatttct
ctcaaaatcattggaatggatctatatcttcacaccgccatgatgtttgtccctagtatg
atgggactcatttttatgacttgtctactgtttatgttcttttataaacgtcttcccaaa
agcctgccagatataccgggccattttcagtctctgcggcatagaaggtaccatcctctt
cattcgccatcagctcctttaccagaacgaaatcaaacaaaaatcatgttgtttgtgctt
gcatttgtttttctcgtcagaatgagtctatttgcagcatcatataccggtatttctgtt
cctctagtcgctgtcatcggatcttttatcctgttgagctggagatggatttatttcaaa
acctccccaagagacttgttatataaatcgccttggcacatttttatattcgcttttact
atgtatgtcttaatttatggtctgcataatattggattcacagagttacttgtgagttat
tttgaacctgtggtttctggaagcctcgcccatgcaactttcgcatcaggtatctctact
tcagttttttctaatctctttaacaaccatccagcgttaatgatcagtacttttacctta
actgaaatgaccctgaatccttcaacaacaaaaatcatctacttggcaaatattatcggc
agtgatatcggttcattattattacctatgggaaccttagcaacgcttatttggatgcat
atattaaaacagcatgatgaaagtatttcatggggcgaatatataaaaacgaccattatc
atcattccgctgactgttctttttacgttaacatgtttatatttttggatcagttggtta
tttctttag

DBGET integrated database retrieval system