KEGG   Bacillus subtilis subsp. subtilis 168: BSU36040Help
Entry
BSU36040          CDS       T00010                                 

Gene name
ywrJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642 DUF150_C
Motif
Other DBs
NCBI-GeneID: 936867
NCBI-ProteinID: NP_391485
Pasteur: BG12526
BSORF: BG12526
UniProt: O05223
Position
complement(3714002..3714679)
Genome map
AA seq 225 aa AA seqDB search
MKGLNQFLNTDVEVVISGDTRFVGTLIDIGQDIFVIFDGCNYLYIPLLHLHQINKAKIVT
STEKPFLINPEDPMIEAETQAFSYRNTLNKVKGQFIEVYVTGGRSIHGYVTNVLNDYIVF
FSPVFKILFISMHHLKWFTPYSTEQTPYTLDNSQLPVVPSKVPLVRNFEEQIKKNIGELV
IFDMGEVPEKVGLLKGVSNNIIELINASGEPVIWKLNHLKTMHLP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggtttgaatcaattccttaacacagatgttgaggttgtcatttcaggagataca
aggtttgtcggcaccctcatagatatcggacaggatatttttgttatttttgatggctgc
aattatctttatattcccttgttgcatcttcatcaaataaacaaggcgaaaatagtgacc
agtactgagaagccatttttgatcaatccggaagatccaatgatagaggcagaaactcaa
gctttttcatatagaaatacattaaacaaggtcaaaggccagtttattgaagtttatgta
actgggggtcgatcgatccatggatatgttacaaatgttttaaacgattatattgtattt
ttctcacccgtatttaaaatactttttatatctatgcatcatttaaaatggtttacccct
tattcaactgaacaaacaccgtatactcttgacaactcacaattgccggtcgtgccttcc
aaagttcctcttgtgcgtaattttgaggagcagatcaaaaaaaatattggtgaattggtc
atatttgatatgggagaggtgccagaaaaagtcggactattaaagggtgtctctaataat
atcattgagcttattaacgcaagtggagagccagtcatttggaagttaaatcatctaaag
acaatgcatcttccctag

DBGET integrated database retrieval system