KEGG   Bacillus subtilis subsp. subtilis 168: BSU36050Help
Entry
BSU36050          CDS       T00010                                 

Gene name
cotB
Definition
(RefSeq) spore coat protein B
  KO
K06325  spore coat protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU36050 (cotB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642 Coilin_N
Motif
Other DBs
NCBI-GeneID: 936870
NCBI-ProteinID: NP_391486
Pasteur: BG10491
BSORF: BG10491
UniProt: P07789
Position
complement(3714739..3715881)
Genome map
AA seq 380 aa AA seqDB search
MSKRRMKYHSNNEISYYNFLHSMKDKIVTVYRGGPESKKGKLTAVKSDYIALQAEKKIIY
YQLEHVKSITEDTNNSTTTIETEEMLDADDFHSLIGHLINQSVQFNQGGPESKKGRLVWL
GDDYAALNTNEDGVVYFNIHHIKSISKHEPDLKIEEQTPVGVLEADDLSEVFKSLTHKWV
SINRGGPEAIEGILVDNADGHYTIVKNQEVLRIYPFHIKSISLGPKGSYKKEDQKNEQNQ
EDNNDKDSNSFISSKSYSSSKSSKRSLKSSDDQSSKSGRSSRSKSSSKSSKRSLKSSDYQ
SSKSGRSSRSKSSSKSSKRSLKSSDYQSSKSSKRSPRSSDYQSSRSPGYSSSIKSSGKQK
EDYSYETIVRTIDYHWKRKF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaggagaatgaaatatcattcaaataatgaaatatcgtattataactttttg
cactcaatgaaagataaaattgttactgtatatcgtggaggtccggaatctaaaaaagga
aaattaacagctgtaaaatcagattatatagctttacaagctgaaaaaaaaataatttat
tatcagttggagcatgtgaaaagtattactgaggataccaataatagcaccacaacaatt
gagactgaggaaatgctcgatgctgatgattttcatagcttaatcggacatttaataaac
caatcagttcaatttaaccaagggggtccggaatctaaaaaaggaagattggtctggctg
ggagatgattacgctgcgttaaacacaaatgaggatggggtagtgtattttaatatccat
cacatcaaaagtataagtaaacacgagcctgatttgaaaatagaagagcagacgccagtt
ggagttttggaagctgatgatttaagcgaggtttttaagagtctgactcataaatgggtt
tcaattaatcgtggaggtccggaagccattgagggtatccttgtagataatgccgacggc
cattatactatagtgaaaaatcaagaggtgcttcgcatctatccttttcacataaaaagc
atcagcttaggtccaaaagggtcgtacaaaaaagaggatcaaaaaaatgaacaaaaccag
gaagacaataatgataaggacagcaattcgttcatttcttcaaaatcatatagctcatca
aaatcatctaaacgatcactaaaatcttcagatgatcaatcatccaaatctggtcgttcg
tcacgttcaaaaagttcttcaaaatcatctaaacgatcactaaaatcttcggattatcaa
tcatccaaatctggccgttcgtcacgttcaaaaagttcttcaaaatcatctaaacgatca
ttaaaatcttcagattatcaatcatcaaaatcatctaaacgatcaccaagatcttcagat
tatcaatcatcaagatcaccaggctattcaagttcaataaaaagttcaggaaaacaaaag
gaagattatagctatgaaacgattgtcagaacgatagactatcactggaaacgtaaattt
taa

DBGET integrated database retrieval system