KEGG   Bacillus subtilis subsp. subtilis 168: BSU36060Help
Entry
BSU36060          CDS       T00010                                 

Gene name
cotH
Definition
(RefSeq) inner spore coat protein H
  KO
K06330  spore coat protein H
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU36060 (cotH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CotH Ribosomal_L23eN
Motif
Other DBs
NCBI-GeneID: 936858
NCBI-ProteinID: NP_391487
Pasteur: BG11791
BSORF: BG11791
UniProt: Q45535
Position
complement(3716009..3717097)
Genome map
AA seq 362 aa AA seqDB search
MKNQSNLPLYQLFVHPKDLRELKKDIWDDDPVPAVMKVNQKRLDIDIAYRGSHIRDFKKK
SYHISFYQPKTFRGAREIHLNAEYKDPSLMRNKLSLDFFSELGTLSPKAEFAFVKMNGKN
EGVYLELESVDEYYLAKRKLADGAIFYAVDDDANFSLMSDLERETKTSLELGYEKKTGTE
EDDFYLQDMIFKINTVPKAQFKSEVTKHVDVDKYLRWLAGIVFTSNYDGFVHNYALYRSG
ETGLFEVIPWDYDATWGRDIHGERMAADYVRIQGFNTLTARILDESEFRKSYKRLLEKTL
QSLFTIEYMEPKIMAMYERIRPFVLMDPYKKNDIERFDREPDVICEYIKNRSQYLKDHLS
IL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaatccaatttaccgctttatcagctgtttgttcatccaaaagacttgcgt
gaattaaaaaaggatatatgggacgatgatccggtgccagctgtgatgaaggtaaatcaa
aaaaggctggatattgatatcgcttatcggggatcacatatcagagacttcaaaaagaag
tcataccatatttccttttatcagccgaaaacattccgcggcgcgcgagagattcactta
aatgcggagtataaagacccttccttgatgagaaacaaattgtctctggattttttctcg
gagctagggacactgtctccaaaggcagagtttgcgtttgtaaagatgaatgggaagaat
gaaggggtttatcttgaacttgaatccgtagatgaatattatttggcgaaaaggaagctg
gctgatggcgcgattttttatgcggtggatgatgatgccaacttttctctgatgagcgat
ttagaaagggaaacgaaaacatcgctggagcttggatatgaaaagaaaacagggactgag
gaagatgatttttatttacaagatatgatttttaaaattaatacggtccctaaagctcag
tttaagtcagaagtgacaaaacacgtggatgtcgataagtatttgcgctggcttgctggt
attgtattcacctcgaactatgacgggtttgtccacaactacgcattatacagaagcggg
gaaaccggattatttgaggtgattccttgggattatgatgcgacttggggcagggatatc
catggagagcggatggctgccgattatgtaagaattcaaggatttaatacactaaccgcc
cggatattggatgaatccgagtttcgcaagtcctacaagcgcctgttagaaaaaacgctc
caatctctttttacaatagaatatatggaaccgaaaatcatggcgatgtatgaacggatt
aggccgtttgtcctcatggacccgtataaaaagaatgatattgagcgttttgaccgtgag
ccggatgtgatctgcgagtatattaaaaaccgttcacaatacctcaaagatcatttaagt
attttatga

DBGET integrated database retrieval system