KEGG   Bacillus subtilis subsp. subtilis 168: BSU36070Help
Entry
BSU36070          CDS       T00010                                 

Gene name
cotG
Definition
(RefSeq) spore coat protein G
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936865
NCBI-ProteinID: NP_391488
Pasteur: BG11017
BSORF: BG11017
UniProt: P39801
Position
3717238..3717825
Genome map
AA seq 195 aa AA seqDB search
MGHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSHKKSHRTHKKSRSHKKSYCSHKKSR
SHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSRSYKKSYRSYKKSRSYKKSCRS
YKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRSHKKYYKKPHHHCDDYKRHDDYDSKKE
YWKDGNCWVVKKKYK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgggccactattcccattctgacatcgaagaagcggtgaaatccgcaaaaaaagaaggt
ttaaaggattatttataccaagagcctcatggaaaaaaacgcagtcataaaaagtcgcac
cgcactcacaaaaaatctcgcagccataaaaaatcatactgctctcacaaaaaatctcgc
agtcacaaaaaatcattctgttctcacaaaaaatctcgcagccacaaaaaatcatactgc
tctcacaagaaatctcgcagccacaaaaaatcgtaccgttctcacaaaaaatctcgcagc
tataaaaaatcttaccgttcttacaaaaaatctcgtagctataaaaaatcttgccgttct
tacaaaaaatctcgcagctacaaaaagtcttactgttctcacaagaaaaaatctcgcagc
tataagaagtcatgccgcacacacaaaaaatcttatcgttcccataagaaatactacaaa
aaaccgcaccaccactgcgacgactacaaaagacacgatgattatgacagcaaaaaagaa
tactggaaagacggcaattgctgggtagtcaaaaagaaatacaaataa

DBGET integrated database retrieval system