KEGG   Bacillus subtilis subsp. subtilis 168: BSU36080Help
Entry
BSU36080          CDS       T00010                                 

Gene name
ywrF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-GeneID: 936871
NCBI-ProteinID: NP_391489
Pasteur: BG12525
BSORF: BG12525
UniProt: O05220
Position
3717999..3718616
Genome map
AA seq 205 aa AA seqDB search
MYIFQADQLSAKDTYKLLSGTVIPRPIAFVTTLSSGGAVNAAPFSFYNVVSSDPPLLSIS
VNRTEGRQKDTARNAVENGEFVVHVSDEAIIEDINETAASLRPDESELTRTSLHPVESKA
VSVPGIKEARVRFECKLERHITFDNDQGITTADLLIGRVVCFHLDEKVYDAEKGYILTDE
LKPASRLAGNHYAKLGEEFTLIRPS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtacatatttcaagctgatcagcttagtgccaaagacacatacaagctattgtcaggt
accgttattccccgccccattgcatttgtgacaacactttcttcaggaggagcggtaaat
gccgcgcctttcagtttttataacgtcgtcagctcagatcctccgcttctcagtatttct
gttaacaggacggaaggacgccaaaaagatacagcacgaaacgcagtggagaacggagaa
tttgtcgttcatgtcagtgatgaagccatcattgaagatatcaatgaaacagctgcaagc
ttaaggccggatgaaagcgagcttacacgcacctcgcttcatcctgttgaaagcaaagct
gtttcagttcccggcattaaggaagcccgcgttcgctttgagtgcaaattagagcggcat
attacctttgacaatgatcaaggcatcactacagcagatctgctcatcggaagagttgtc
tgcttccacctagatgaaaaggtgtatgatgcagaaaagggatatattttaacggatgaa
ttaaagcctgcctcacgattggcgggaaatcactatgccaagctgggggaagaattcaca
ctgattcgtcccagctga

DBGET integrated database retrieval system