KEGG   Bacillus subtilis subsp. subtilis 168: BSU36090Help
Entry
BSU36090          CDS       T00010                                 

Gene name
ywrE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4181 Voltage_CLC
Motif
Other DBs
NCBI-GeneID: 936874
NCBI-ProteinID: NP_391490
Pasteur: BG12524
BSORF: BG12524
UniProt: O05219
Position
3718794..3719129
Genome map
AA seq 111 aa AA seqDB search
MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFF
PVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttttggattttaatgctgatcgctattaccatcagtctcgcctctcaattt
tttataaagaaaaaatacggtattgataaatccggctggcgatataagcatgtcagcaat
acacacaaatggatcgaaatcactttacttattttgtttgtgttttcactctcctttttt
ccagttgaatatttgcttcttttattttttattgtgattgactcaatacgtatttttatg
gagtggcattatagacctgaagataaacagtatatgtaccacattgtagaggtctccctt
atgtttatgcttttgatttatgtttgtaccctatag

DBGET integrated database retrieval system