KEGG   Bacillus subtilis subsp. subtilis 168: BSU36100Help
Entry
BSU36100          CDS       T00010                                 

Gene name
ywrD
Definition
(RefSeq) gamma-glutamyltransferase YwrD
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00430  Taurine and hypotaurine metabolism
bsu00460  Cyanoamino acid metabolism
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU36100 (ywrD)
   00460 Cyanoamino acid metabolism
    BSU36100 (ywrD)
   00480 Glutathione metabolism
    BSU36100 (ywrD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU36100 (ywrD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BSU36100 (ywrD)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BSU36100 (ywrD)
Peptidases [BR:bsu01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   BSU36100 (ywrD)
CD molecules [BR:bsu04090]
 Proteins
  BSU36100 (ywrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 936884
NCBI-ProteinID: NP_391491
Pasteur: BG12523
BSORF: BG12523
UniProt: O05218
Position
complement(3719134..3720711)
Genome map
AA seq 525 aa AA seqDB search
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFW
LTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYG
RLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTPYTADIFTRRGKAPVPGERFV
QKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYR
GYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDP
AFADIPLERLLDKRYAKQLAEEIGYLAIPAESRPVGSDTAYAAVIDADGNAVSFIQSLYF
EFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQ
GGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDKTIQKLK
DSGHLVEVVGDYDPLMGQAAAIKVDEEGFLQGGADPRGDGAAVGI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatctgtcatcggtacaaagcaaatggtcgtcagtccgcattatctcgcttct
caagccggaaaccgcatactggataagggaggcaacgcgtttgacgccgctgttgcggtg
agtgcttgtcttgcggttgtgtacccgcatatgaccggacttggcggggattccttttgg
ctgacctttcaccaggaaacaaaggcagtaaaagtctacaatggcagcggccgttcagga
aaaaacgtaacgagagatgtatataagggaaaaagcgcgattccgctgcggggaattgac
agtgctattaccgtgccgggaatggttgatagctgggatgcggtcctgaaggagtacggg
cgtctgtctcttgcagatgtattggagcccgcacgcgattatgcccaaaatgggtttcct
gtatcagctgatcagtgtcgtcacacagaaaagaatattgaactgctggcttccacgcct
tacacggctgacatcttcacgagaaggggcaaagcacctgtcccgggagagcggtttgtg
caaaaagagcttgcagacagtctgaacttgattgctgaaaaaggaagaagcgcattttat
gaaggagatctcgctcagcggattgtctcacatttacagaataacggcagttacatgaca
atcgatgattttaaagcgcatcggggtgagtgggcagcgcctgtatcaagtgattatcga
ggatacagtgtgtatcaggcgccgccgaattctcagggatttaccggtttattaacactg
aacattttggaaaactatgatttcacccaaatcgaacacggttcatttgagtattatcac
gtgcttgtggaggcattgaaaaagagttttctagatcgggatgccgtcctgactgatccg
gcgtttgcagacattccgcttgaaaggcttttggacaaacgttatgcaaaacaattggca
gaagaaatcggctatctcgcaataccggcagaaagcaggccggtgggaagtgatacggca
tatgcggccgtaatcgatgcggatggcaacgcagtgtcattcattcaaagcctgtacttt
gaatttggctcggcagtcactgccggtgatacaggcatattactgcaaaaccgcggatcg
tttttctcactggatgaaaatcatgtcaacacgcttgaaccgagaaagcgcaccttccat
acgttgatgccggctatggtctgtaaaggcggaaagccaaaaattctgtacggcacacaa
ggcggcgaaggccagccgcagacccagacggccatcattacccgaatgctggactacgga
atgcatccacagcaggcaatcagcgaaccgcgctgggtatggggcagaacgtggggagag
gaatacgaaggtctcagagtcgagggcagattcacagacaaaacaatccaaaaactgaaa
gacagcgggcatctcgtggaggttgtcggtgactatgatccgctgatgggacaagcggct
gcaatcaaagttgatgaagaaggctttctccaaggcggagccgatcctcggggagacgga
gcggctgtggggatttaa

DBGET integrated database retrieval system