KEGG   Bacillus subtilis subsp. subtilis 168: BSU36110Help
Entry
BSU36110          CDS       T00010                                 

Gene name
ywrC
Definition
(RefSeq) HTH-type transcriptional regulator YwrC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AsnC-type HTH_24 AsnC_trans_reg HTH_Mga MarR HTH_11 MarR_2 HTH_20 TrmB HTH_Crp_2 TFIIE_alpha FeoC HTH_27
Motif
Other DBs
NCBI-GeneID: 936886
NCBI-ProteinID: NP_391492
Pasteur: BG12522
BSORF: BG12522
UniProt: O05217
Position
3720925..3721401
Genome map
AA seq 158 aa AA seqDB search
MSHEYQIPNLVLDETDKQILTILHEEGRISYTDLGKRVDLSRVAVQARINQLIEAGVIEK
FTAVINPAKIGIHVSVFFNVEVEPQFLEEVALKLEEEPAVTSLYHMTGPSKLHMHGIFTN
DQEMEEFLTKRLYPLRGVVSVDCQMLIKRYKSRMGMKL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcatgaatatcaaatccccaaccttgtacttgatgagactgataaacaaattctc
acgattttgcatgaagaaggcagaatttcttatacggatcttggcaaaagagtcgatttg
tcacgggtcgccgttcaggcccgtatcaaccaattaattgaagccggtgttattgaaaaa
ttcaccgctgtcatcaatcccgctaaaatcggcatccatgtttccgtgtttttcaatgtc
gaggtagaaccgcaatttttagaagaggtcgctcttaagcttgaggaagagcctgcggtc
accagcctttatcacatgacaggcccgagcaagctgcatatgcatgggatctttaccaac
gatcaagaaatggaagaattcttaacaaaacggctgtatccattgcgaggcgtcgtcagt
gttgattgccagatgctgatcaaacgatacaaaagccgtatgggaatgaagctgtaa

DBGET integrated database retrieval system