KEGG   Bacillus subtilis subsp. subtilis 168: BSU36120
Entry
BSU36120          CDS       T00010                                 

Gene name
ywrB
Definition
(RefSeq) transporter
  KO
K07240  chromate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36120 (ywrB)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU36120 (ywrB)
Motif
Pfam: Chromate_transp DUF973 Zip
Other DBs
NCBI-GeneID: 936876
NCBI-ProteinID: NP_391493
Pasteur: BG12521
BSORF: BG12521
UniProt: O05216 A0A6M4JPV3
Position
3721415..3722008
AA seq 197 aa
MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGP
IATKMAAYLGFKLKGTLGAIVAILAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPV
IAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKL
KDKITNKHSKDKGMSAS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaaaaaccatccttatcgggatatgacggccgcaatggttcgcaccggcatattaggg
ttcggcggcggaccttccgtgattccgctgatccgccatgaagcggtcaataaatataaa
tggattgacgatgatgaattcggagaaatattagcaatcgctaatgcgcttcccggaccg
attgccaccaaaatggctgcttatctgggctttaagctaaaaggcacattaggtgcaatt
gtggcgatcctcgcccacattctgcctacatgtcttgcgatggtgggcttgtttgcggct
gtaaatgtgttaagccattcagcaattgttgcaggtatgattggtgccgtcacgccggta
attgcggtcatgctcggaatcatggcgtacgagtttggccaaaaagcgcttaaaggtttc
ggctgggttaccggcatcctgttttttatcatcgcttttatcggcctgcaaactttacag
attaatcccggcctggtcattatcattttcttagcttacggggcgtttcattttaaactg
aaagacaaaatcacaaataaacattcaaaagataaaggaatgtcagcctcatga

DBGET integrated database retrieval system