KEGG   Bacillus subtilis subsp. subtilis 168: BSU36130Help
Entry
BSU36130          CDS       T00010                                 

Gene name
ywrA
Definition
(RefSeq) transporter
  KO
K07240  chromate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36130 (ywrA)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU36130 (ywrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chromate_transp
Motif
Other DBs
NCBI-GeneID: 936879
NCBI-ProteinID: NP_391494
Pasteur: BG12520
BSORF: BG12520
UniProt: O05215
Position
3722005..3722541
Genome map
AA seq 178 aa AA seqDB search
MISIYLFMAFFIANLLGYGGGPASIPLMFEEVVNRYSWLSNDQFSNMLALANALPGPIAT
KIAAYVGYSAGGWPGFLIALIATVVPSALALIVLLRIIQRFRQSPVIKGMTLSVQPVIAV
MMLILTWQIGADGIKAIGWVQSIVITGISLLAMTKFKMHPAFLIIAAFLYGGLVIPYL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgatctatttatttatggcgttttttatcgcaaacctactgggatatggcggc
ggacctgcgtctatcccgctaatgtttgaagaagtcgtaaacagatacagctggctctca
aacgatcaattctcaaatatgctcgcacttgcgaacgcattgccgggcccgatcgccacg
aaaatcgctgcgtatgtcggctacagcgcaggcgggtggcccggcttcctaattgccctg
atcgcaaccgtcgtaccgtcggcgctcgcattgatcgtcctgctgcgcatcatccagcgc
ttccgccaatcacctgtcatcaaaggcatgacgctgtccgtccagcctgtcatcgcggtc
atgatgctcattcttacctggcaaatcggcgcagacggcatcaaagcgatcggctgggtc
caatcgatcgtgattacgggaatttcgctccttgccatgacaaaattcaaaatgcatccg
gcatttttgattattgcggcgtttttatatgggggccttgtgatcccttatttatag

DBGET integrated database retrieval system