KEGG   Bacillus subtilis subsp. subtilis 168: BSU36140Help
Entry
BSU36140          CDS       T00010                                 

Gene name
ywqO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4727
Motif
Other DBs
NCBI-GeneID: 936881
NCBI-ProteinID: NP_391495
Pasteur: BG12519
BSORF: BG12519
UniProt: P96727
Position
complement(3722568..3722789)
Genome map
AA seq 73 aa AA seqDB search
MKFLLSVIAGLLILALYLFWKVQPPVWIQVETNSSQLKQSVRMAGTTLQVKHMIKSDAGE
ETAVISNGISGLK
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttgctgtcggtcattgctggcttgctgattcttgcactctatttattttgg
aaggtccagcctcctgtttggatacaagttgaaaccaattcgtcccagttgaagcaatct
gtgagaatggcaggaaccacgctgcaagtcaagcacatgatcaagagtgacgcaggagaa
gaaacagctgtcatatcaaacggcatttctgggctaaaataa

DBGET integrated database retrieval system