KEGG   Bacillus subtilis subsp. subtilis 168: BSU36150Help
Entry
BSU36150          CDS       T00010                                 

Gene name
ywqN
Definition
(RefSeq) NAD(P)H-dependent FMN-containing oxidoreductase YwqN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-GeneID: 936882
NCBI-ProteinID: NP_391496
Pasteur: BG12518
BSORF: BG12518
UniProt: P96726
Structure
PDB: 

Position
complement(3722786..3723331)
Genome map
AA seq 181 aa AA seqDB search
MKIAVINGGTRSGGNTDVLAEKAVQGFDAEHIYLQKYPIQPIEDLRHAQGGFRPVQDDYD
SIIERILQCHILIFATPIYWFGMSGTLKLFIDRWSQTLRDPRFPDFKQQMSVKQAYVIAV
GGDNPKIKGLPLIQQFEHIFHFMGMSFKGYVLGEGNRPGDILRDHQALSAASRLLKRSDA
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcggttattaacggcggaactcggtctggcggaaatacggatgttcttgcg
gagaaggctgttcaaggattcgatgcggagcacatttatttgcagaaatatccaattcaa
ccaattgaagatctgcgtcacgcccaaggcggctttcgtcctgttcaagatgactacgat
tctatcattgaacggatattgcagtgccatattcttatattcgccaccccaatttattgg
tttggcatgtcagggacattaaagctgtttattgatcgctggtcacagacgttgagagat
ccgagatttcctgattttaaacagcaaatgtcagtgaaacaggcatatgtaatagcagtg
ggcggagacaatccaaaaataaaagggctgccgctgattcagcaattcgaacatattttt
cattttatgggaatgtcctttaaaggctatgtgctgggagaaggcaatcgtccaggcgat
attcttcgtgatcatcaggcgctgtccgctgcgagccgcttactgaaaagaagcgatgcg
atatga

DBGET integrated database retrieval system