KEGG   Bacillus subtilis subsp. subtilis 168: BSU36160Help
Entry
BSU36160          CDS       T00010                                 

Gene name
ywqM
Definition
(RefSeq) HTH-type transcriptional regulator YwqM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 936887
NCBI-ProteinID: NP_391497
Pasteur: BG12517
BSORF: BG12517
UniProt: P96725
Position
3723454..3724335
Genome map
AA seq 293 aa AA seqDB search
MELKQLITFITAAEHVNFTLTAKMLNYAQSSVTSQIKSLEEEIGTPLFERLGKRLILTEA
GKTFKSYAQKIIALTEEAKMATNQVRETTGTLKIGATESQCTYRLPPIIKEFKQAFPQVK
LIFKPYISNEQAKEQLLQGQLDITFILDVNRMEDALHVESLIQDEIKMVAANDHPFPADL
PVTLKDLQNETLLLTEDGCSYRTLFENNLHDSGIYPNKLEFVSIEAIKQCVMAGLGIGIL
PEMTVKDDIAAGRMKELNWQSDCPVFTQLAWHKDKWMSAPLKAFIDLTRKTFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtggaattgaagcagctgatcacctttattacggcggctgaacatgtaaacttcacccta
accgccaaaatgcttaattatgcacaatcaagcgttacctctcagatcaaatcacttgaa
gaagaaatcggaacgcctttatttgaacggctcggcaagcggcttatcttgacagaagca
ggaaaaacgttcaaatcttatgcacagaagatcattgcgttaacagaagaagcgaaaatg
gccacaaatcaagtaagagaaacaaccggaaccttaaaaatcggggcgacggaaagccag
tgcacataccgcctgccccctatcataaaagaatttaaacaggcttttccccaagtaaag
ctcatattcaaaccatatatctccaatgaacaagcgaaagaacagctcttacagggccag
cttgatatcaccttcatcttggatgtaaaccggatggaagacgcactgcacgttgaatct
ttgattcaggatgagatcaaaatggtggctgctaatgaccatccttttcctgcggattta
ccagtaacattgaaggatcttcaaaacgaaactcttctgctgacagaggacggctgctcg
taccgcacgctctttgagaacaatttgcatgactccggtatctatcctaacaaattggaa
ttcgtcagcatagaagccatcaaacaatgcgtgatggccggacttgggattggaatcttg
cctgaaatgacagtaaaagatgatattgcagcaggccggatgaaagaactcaattggcag
agcgattgccccgttttcactcaattagcatggcataaggacaagtggatgtctgcgcca
ttaaaggcttttatcgatttgacacggaaaacattcaaataa

DBGET integrated database retrieval system