KEGG   Bacillus subtilis subsp. subtilis 168: BSU36170Help
Entry
BSU36170          CDS       T00010                                 

Gene name
ywqL
Definition
(RefSeq) endonuclease V
  KO
K05982  deoxyribonuclease V [EC:3.1.21.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU36170 (ywqL)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.7  deoxyribonuclease V
     BSU36170 (ywqL)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     BSU36170 (ywqL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Endonuclease_5
Motif
Other DBs
NCBI-GeneID: 936894
NCBI-ProteinID: NP_391498
Pasteur: BG12516
BSORF: BG12516
UniProt: P96724
Structure
PDB: 

Position
complement(3724420..3725136)
Genome map
AA seq 238 aa AA seqDB search
MKVFDVHKFDMKKEQDFLQVQFNLKNRINLSPTIHPDSINTCAGVDLAYWEQDGEPYGVC
CIIVIDADTKEVIEKVHSMGRISVPYVSGFLAFRELPLIIEAAKKLETEPDVFLFDGNGY
LHYNHMGVATHAAFFLGKPTIGIAKTYLKIKGCDFVTPEIEVGAYTDIIIDGEVYGRALR
TRRDVKPIFLSCGNYIDLDSSYQITMSLINQESRLPIPVRLADLETHVLRTFYQKNHV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtatttgatgtgcataaatttgatatgaaaaaggaacaagactttttacaagtg
caatttaaccttaaaaatcgtatcaacctatcccccacgatccatccagactccatcaac
acctgcgcaggcgtcgacctggcctattgggagcaggatggagaaccatacggagtgtgc
tgtattatcgtaattgacgctgatacaaaagaagtcattgaaaaagtgcacagcatgggg
agaatcagcgtgccgtatgtttccggttttcttgcgtttcgcgagctgcccttgatcatc
gaggcggcgaaaaagctggagacggagccggatgtcttcttgtttgatggcaacggatat
ctgcattacaatcatatgggcgttgccacccatgcggctttttttctgggcaagccgacg
attgggatagcgaaaacctatctcaaaatcaaaggctgcgatttcgtgacgcctgaaatt
gaagtaggcgcatacaccgatattatcattgacggcgaggtatatggacgggcgctgcga
acgcggcgggacgtgaagcctattttcttgtcttgcggtaattatattgatttagacagc
agctatcagatcacgatgagcttgatcaatcaagaaagcaggctgccgatccctgtccgc
ctggctgaccttgagacgcatgttttgcgaacgttttatcagaaaaatcacgtgtaa

DBGET integrated database retrieval system