KEGG   Bacillus subtilis subsp. subtilis 168: BSU36180Help
Entry
BSU36180          CDS       T00010                                 

Gene name
ywqK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MORN_2 RhgB_N
Motif
Other DBs
NCBI-GeneID: 936888
NCBI-ProteinID: NP_391499
Pasteur: BG12515
BSORF: BG12515
UniProt: P96723
Position
complement(3725146..3725610)
Genome map
AA seq 154 aa AA seqDB search
MENEYDMKSIKEKGVDFEDLWFSSVSDEILDNPEDENGQPFTGLAYELYPNGQIIYFTKY
KNGLAHGLTCEFYENGNKKSEKEYRYGQLHGISIIWFENGRKKSEQQYEHSILISEKNWD
EEGNLLNKYEIDTDSPHFEILESRRETHINLGRE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaatatgatatgaagagtataaaagaaaagggagtggactttgaggattta
tggttctcttcggtaagtgatgagattttagataatcctgaagacgaaaatggccagccg
tttacagggctggcttacgaattatatccaaatggtcaaatcatctattttactaaatat
aagaatggtctggcccatggtttaacatgtgaattttatgaaaacgggaataaaaaaagt
gaaaaagaataccgatatgggcaattgcacggtataagcataatttggtttgaaaatggc
aggaaaaaaagtgagcaacagtatgagcattccatactaatttctgaaaagaattgggat
gaagaaggcaatctattaaataagtacgagatagatacagatagtcctcattttgaaata
ctagaatcgagaagagagactcacattaatttaggtcgagagtga

DBGET integrated database retrieval system