KEGG   Bacillus subtilis subsp. subtilis 168: BSU36190Help
Entry
BSU36190          CDS       T00010                                 

Gene name
ywqJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LXG YwqJ-deaminase PT-TG dCMP_cyt_deam_1 MafB19-deam Antimicrobial19 DUF2935
Motif
Other DBs
NCBI-GeneID: 936885
NCBI-ProteinID: NP_391500
Pasteur: BG12514
BSORF: BG12514
UniProt: P96722
Position
complement(3725600..3727408)
Genome map
AA seq 602 aa AA seqDB search
MSKVFESKSLIEEAKSRKKQYETLEEQLNTLKKAFQGVADLGDNFKGNGADNIKDFFQGQ
AEIVDSWLTLVSAQIAFLNGISGDIKDQELNDSYVETSFLDHELPNGDLKASEIVSAHKE
EIDSILSGISDIIDLDMYTLDDYADKMGDAQKIRRDTITAVDKLDESLTTEYQNLESLDN
AVLTKYSVLMQATSNGKSASPMYYDKKAFHSNEVYKSVIEVENQGTTYIDAKTQQAEARR
LQEKAEEEANKPWYEKTWDGVCNFTGEVTGYYDYKRATEGVDPVTGEKLSTAERVTAGAM
AAAGFIPVVGWAGRAFKGGKAIYKTGKAAIAAEHALDAYKTGKSLDILKMTEMGAYGLVA
SNGFSEAVTGRDMFGNKVSEEKRKQGALEAITIIGGAGLAHYFDRLYQKNAPYVNKVSNE
SLISNIAKTTEEKQTRLQYLRNKHGVLSKEDLHHRINLRAEVLNELSRIKSSGLTKKQRG
PAVAGVLDKKTGNYYFGINNIDGKPPKVLHPLIHDRIVNMPTELKEGYIKTSGAGSHAEV
NALNEALLQRPDADLKDLMVYVVSARKINKKMPEGVPMPRCPHCEYITQNTNYIPEALKY
GK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtatttgaatcaaaatctttaatcgaagaagcgaagagcagaaaaaagcaa
tatgagacgcttgaagagcagctgaatacgctgaaaaaagcgtttcagggagttgccgat
ttaggcgataattttaaaggaaatggcgcggacaatattaaagatttttttcagggacag
gcagaaatcgtagacagctggctgacgcttgtctctgctcaaattgcgtttttaaacggc
atttcaggagatattaaagatcaagaactgaatgattcatatgtggaaacttcttttttg
gatcatgagctgcccaatggagacctgaaagcctcagagattgtctccgctcataaagaa
gaaatcgattctattttgtcaggcatcagcgatattattgatctcgacatgtacacgctt
gacgactatgcagataagatgggcgatgcccaaaaaatcagacgtgatacaatcacagct
gtcgataagcttgatgaatccctgaccactgaatatcaaaatttagaatctctggacaac
gcagtgctcaccaaatattctgttctcatgcaggccaccagcaatgggaagagcgcatcc
cctatgtactatgacaaaaaagccttccacagcaatgaagtctacaaaagcgtcattgaa
gtagaaaatcaaggaacaacctatatcgatgcaaaaacccagcaagcagaagcaagacgg
ctccaggaaaaagccgaggaagaagcaaacaaaccgtggtacgaaaaaacatgggatgga
gtttgcaactttactggagaagtcactggctattatgattataaaagagcaaccgaaggc
gttgatccggttaccggagaaaaactctccaccgcggagcgtgtgacagcaggagctatg
gccgctgccggattcataccagtcgtcggctgggcaggccgggccttcaaaggcggaaaa
gccatctacaaaaccggaaaagcagctatcgctgctgaacacgcattagacgcctacaaa
acaggcaaatccttagacattctcaaaatgacagaaatgggcgcatacggccttgttgcg
tcaaacggattctcagaagctgtcacaggccgggatatgttcggaaacaaagtgtctgag
gagaagcggaagcaaggggcgctggaagctattactattattggtggagcaggattggca
cactactttgatcggttgtaccaaaaaaatgctccatatgtcaataaagtgagtaatgaa
agccttattagcaatattgctaagactactgaagaaaaacaaactaggcttcaatattta
agaaataagcatggtgtattgtctaaagaagatcttcaccatcgaataaatctaagggca
gaagtactaaacgaacttagtagaattaaatcttctggtctaactaaaaaacaaagaggc
cctgcggtagctggtgtattggacaaaaaaacaggcaattattattttggaataaacaat
atagatgggaagccacctaaggtactacatccacttattcatgatagaattgtaaatatg
cctacagaacttaaagaaggttatataaagacgtcaggggcgggttctcatgccgaagtt
aatgctctaaatgaagcgttacttcaaagacctgatgcggatttaaaagatttaatggta
tatgtagtaagtgctaggaaaataaataaaaagatgccagaaggtgtcccaatgcctaga
tgtccacattgtgaatatataactcaaaatacaaattatataccggaggctttaaagtat
ggaaaatga

DBGET integrated database retrieval system