KEGG   Bacillus subtilis subsp. subtilis 168: BSU36210Help
Entry
BSU36210          CDS       T00010                                 

Gene name
ywqH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5082 Spc7 Helo_like_N Sds3 Prefoldin_2
Motif
Other DBs
NCBI-GeneID: 937905
NCBI-ProteinID: NP_391502
Pasteur: BG12512
BSORF: BG12512
UniProt: P96720
Position
complement(3727697..3728119)
Genome map
AA seq 140 aa AA seqDB search
MGYESMLADIKSSLNGKISDVEDKIEKLKKAKKDIDTLQEEAITEIKEIVKPELGKHWTG
TKADDFDKGREEAKSEASKIVNDKYNEYMASINGKIFDLEWDKAKYASELFIANGAADLL
KKGEEFAEEVGNTISKLKWW
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgaaagtatgctagcggatatcaaaagttcgctcaacggaaaaatttcagac
gtggaagacaagatcgaaaagctgaaaaaagcaaaaaaggacatagacacactgcaagaa
gaggcaatcactgaaatcaaagaaattgtgaaaccggaattgggcaagcattggacggga
acaaaagccgatgatttcgacaagggaagagaagaggcgaaatcggaagcatctaagatt
gtgaatgataaatataacgagtatatggcttcgattaacgggaaaatttttgatcttgaa
tgggataaagctaaatatgcatcggaattgttcatagcaaatggtgcagcagatcttctt
aaaaagggagaagagttcgcggaagaagtcggaaatacaattagtaaactaaaatggtgg
tga

DBGET integrated database retrieval system