KEGG   Bacillus subtilis subsp. subtilis 168: BSU36220Help
Entry
BSU36220          CDS       T00010                                 

Gene name
ywqG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1963
Motif
Other DBs
NCBI-GeneID: 937891
NCBI-ProteinID: NP_391503
Pasteur: BG12511
BSORF: BG12511
UniProt: P96719
Structure
PDB: 

Position
complement(3728511..3729296)
Genome map
AA seq 261 aa AA seqDB search
MNHLPEKMRPYRDLLEKSAKEYVKLNVRKGKTGRYDSKIAGDPYFPKHETYPTDENGQPM
KLLAQINFSHIPQLDGYPSSGILQFYISVHDDVYGLNFDDRCEQKNFRVIYFENIVENDD
ELVSDFSFIGTGECDFPILSEAAVEPVKSSEWVLPTDFQFEQYTGMETMEFFGQFGEDEE
DIYNELAENGFGHKIGGYASFTQHDPREYAYKEHTIMLLQIDSDDDIDSMWGDVGIANFF
ITPEDLRKKDFSNVLYNWDCS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatctgcccgaaaaaatgagaccgtaccgcgacttgctggagaaatcagcgaaa
gaatacgtgaaactgaatgtgagaaaggggaaaacaggacgatatgacagcaaaattgcc
ggtgatccctatttccccaagcatgaaacatatccgactgacgaaaatggacagccgatg
aaacttctggcgcagattaatttctcgcacattccccagcttgacggctacccttcttca
ggtatcctgcagttctacatttctgttcatgatgacgtctatggattgaattttgacgat
cgatgtgaacaaaagaatttcagagtgatctattttgaaaatatcgtagaaaacgatgac
gagcttgtttctgatttttcatttattggcacaggcgaatgtgattttccgattttatca
gaagcggcagtcgagcctgtgaaatcttcggaatgggtgctgcctacagattttcaattt
gagcagtatacgggcatggaaacaatggagttctttggtcagttcggcgaggatgaagaa
gacatttataatgaactggctgaaaacggatttggccataaaattggcggatacgcttct
tttacccagcatgatccccgggaatacgcatataaagaacacaccatcatgctgttacaa
attgattcagacgatgatatcgattcaatgtggggagacgtcggcatcgccaattttttc
atcacacctgaagatctaaggaaaaaagacttttcaaacgttctgtacaactgggactgc
agctaa

DBGET integrated database retrieval system