KEGG   Bacillus subtilis subsp. subtilis 168: BSU36220
Entry
BSU36220          CDS       T00010                                 

Gene name
ywqG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: DUF1963
Other DBs
NCBI-GeneID: 937891
NCBI-ProteinID: NP_391503
Pasteur: BG12511
BSORF: BG12511
UniProt: P96719 A0A6M3ZGQ0
Structure
PDB: 
1PV5

Position
complement(3728511..3729296)
AA seq 261 aa
MNHLPEKMRPYRDLLEKSAKEYVKLNVRKGKTGRYDSKIAGDPYFPKHETYPTDENGQPM
KLLAQINFSHIPQLDGYPSSGILQFYISVHDDVYGLNFDDRCEQKNFRVIYFENIVENDD
ELVSDFSFIGTGECDFPILSEAAVEPVKSSEWVLPTDFQFEQYTGMETMEFFGQFGEDEE
DIYNELAENGFGHKIGGYASFTQHDPREYAYKEHTIMLLQIDSDDDIDSMWGDVGIANFF
ITPEDLRKKDFSNVLYNWDCS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaatcatctgcccgaaaaaatgagaccgtaccgcgacttgctggagaaatcagcgaaa
gaatacgtgaaactgaatgtgagaaaggggaaaacaggacgatatgacagcaaaattgcc
ggtgatccctatttccccaagcatgaaacatatccgactgacgaaaatggacagccgatg
aaacttctggcgcagattaatttctcgcacattccccagcttgacggctacccttcttca
ggtatcctgcagttctacatttctgttcatgatgacgtctatggattgaattttgacgat
cgatgtgaacaaaagaatttcagagtgatctattttgaaaatatcgtagaaaacgatgac
gagcttgtttctgatttttcatttattggcacaggcgaatgtgattttccgattttatca
gaagcggcagtcgagcctgtgaaatcttcggaatgggtgctgcctacagattttcaattt
gagcagtatacgggcatggaaacaatggagttctttggtcagttcggcgaggatgaagaa
gacatttataatgaactggctgaaaacggatttggccataaaattggcggatacgcttct
tttacccagcatgatccccgggaatacgcatataaagaacacaccatcatgctgttacaa
attgattcagacgatgatatcgattcaatgtggggagacgtcggcatcgccaattttttc
atcacacctgaagatctaaggaaaaaagacttttcaaacgttctgtacaactgggactgc
agctaa

DBGET integrated database retrieval system