KEGG   Bacillus subtilis subsp. subtilis 168: BSU36230
Entry
BSU36230          CDS       T00010                                 

Symbol
ywqF
Name
(RefSeq) UDP-glucose 6-dehydrogenase YwqF
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00053  Ascorbate and aldarate metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU36230 (ywqF)
   00053 Ascorbate and aldarate metabolism
    BSU36230 (ywqF)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU36230 (ywqF)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU36230 (ywqF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     BSU36230 (ywqF)
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C NAD_binding_2 NAD_Gly3P_dh_N 3HCDH_N ApbA Pyr_redox Pyr_redox_2 TrkA_N AlaDh_PNT_C NAD_binding_7 NAD_binding_8 FAD_binding_3 DAO
Other DBs
NCBI-GeneID: 936890
NCBI-ProteinID: NP_391504
Pasteur: BG12510
BSORF: BG12510
UniProt: P96718 A0A6M4JPV2
Position
complement(3729488..3730810)
AA seq 440 aa
MNITVIGTGYVGLVTGVSLSEIGHHVTCIDIDAHKIDEMRKGISPIFEPGLEELMRKNTA
DGRLNFETSYEKGLAQADIIFIAVGTPQKSDGHANLEQITDAAKRIAKHVKRDTVVVTKS
TVPVGTNDLINGLITEHLAEPVSISVASNPEFLREGSAIYDTFHGDRIVIGTADEKTANT
LEELFRPFQIPIYQTDIRSAEMIKYASNAFLATKISFINEISNICEKVGADIEAVAYGMG
QDKRIGSQFLKAGIGYGGSCFPKDTNALVQIAGNVEHDFELLKSVIKVNNNQQAMLVDKA
LNRLGGVTGKTIALLGLSFKPNTDDMREAPSIVIADRLAALDARIRAYDPIAVSHAKHVL
PQAVEYKETIEEAVKGSDAVMILTDWADIKQFPLAAYQDLMETPLIFDGRNCYTLDEALA
AGVEYYSVGRKAVVPSGAIQ
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaatataacagtcatcggaacaggctatgtcggtcttgtgacaggtgtttctctttct
gagattggacatcatgtaacctgcattgatattgacgctcacaagattgatgaaatgaga
aagggcatttcccccatatttgaaccaggtcttgaagagctgatgagaaaaaatacagct
gatggacggctgaactttgaaacgagctatgagaaaggcttggcacaggcagacatcatt
tttatagcggtcggcacaccgcagaaaagcgacgggcacgccaatctggagcaaattaca
gatgcggccaaacgcatcgcaaagcatgtcaaacgagatacagtcgtggtaacgaaaagc
acagtgcccgttgggacaaacgatttgattaatggactgattactgaacatctagcggag
cctgtcagtatttcggtcgcatccaatccggaatttttgcgtgaggggtcggcgatctat
gatacctttcatggtgacaggatcgtgatcgggacggccgatgagaaaacagcaaatacg
ctggaggagctcttccgtccgtttcaaatcccgatttaccaaacggatatcagaagcgcc
gagatgatcaaatatgcctcaaatgcttttctggccactaagatcagttttataaacgaa
atttcgaatatatgtgaaaaggtcggcgccgatattgaagcagtcgcatacgggatggga
caggataagcggatcgggagccagtttttaaaagcgggcataggctacggcggctcttgt
tttccaaaggacacaaacgccctcgtgcaaattgccggcaatgtcgagcatgattttgaa
ctgctgaaatccgttatcaaagtcaacaacaatcagcaggcgatgctggttgataaagcg
ctgaacaggctcggtggggtgacgggaaaaacgattgcccttttaggcctgtcatttaaa
ccgaataccgacgatatgagagaagcgccgtcaattgttattgcagaccgtctcgctgcg
ctcgacgcccgtatcagagcctacgatcccattgcagttagccatgcaaagcatgttctc
ccgcaagctgttgaatataaagagacgatcgaggaagctgtcaaagggtctgacgccgtc
atgattttaaccgactgggctgacattaaacaattcccgttagcggcttatcaggatttg
atggaaacgccgctcatatttgacggcagaaactgctacacattggatgaggctttggct
gcaggagtggagtattattctgtcggacggaaggcggttgttccgtcaggtgcaattcaa
tag

DBGET integrated database retrieval system