KEGG   Bacillus subtilis subsp. subtilis 168: BSU36240Help
Entry
BSU36240          CDS       T00010                                 

Gene name
ywqE
Definition
(RefSeq) tyrosine-protein phosphatase YwqE
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU36240 (ywqE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     BSU36240 (ywqE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936893
NCBI-ProteinID: NP_391505
Pasteur: BG12509
BSORF: BG12509
UniProt: P96717
Structure
PDB: 

Position
complement(3731005..3731769)
Genome map
AA seq 254 aa AA seqDB search
MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAAD
QLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQ
LFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSL
RLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQ
PPQPVKRRKLFGFF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatattcactgtcacattcttcccgcaatggatgacggggcaggtgattcggcc
gacagcatagaaatggcaagagcagctgttcgtcagggaatccggacgatcattgcgaca
cctcatcataacaacggtgtgtataaaaacgagccagccgcagtcagagaagcagcagat
cagttaaacaaacgtttaatcaaagaagacattcctttacatgtgcttccgggacaggaa
atcagaatctacggcgaggtggaacaagaccttgccaaacgtcagctgctttcgctgaat
gatacaaaatacatcttgattgagtttccgtttgatcacgttccccgatatgcggagcag
cttttttatgatttgcagctgaaaggatatattccggttatcgcccatcctgaacgcaac
agggaaattcgcgaaaacccgtccttgctgtatcatcttgtggaaaaaggagcagcatct
cagattacttcaggaagtcttgcggggatcttcggcaagcagctgaaagcattttctctc
cggctggttgaagccaatttgatccatttcgtagcctcagatgcccataatgtgaaaacg
agaaattttcacactcaagaggctctttatgttctagagaaagaattcggctcggaactt
ccttatatgctgacggaaaatgcagagcttctcctgcggaatcagaccatcttcagacag
cctccgcagccggtcaaaagaagaaaattgtttggttttttttaa

DBGET integrated database retrieval system