KEGG   Bacillus subtilis subsp. subtilis 168: BSU36250Help
Entry
BSU36250          CDS       T00010                                 

Gene name
ptkA
Definition
(RefSeq) tyrosine-protein kinase YwqD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 ParA CbiA MipZ CBP_BcsQ Fer4_NifH ArsA_ATPase SRP54 AAA_25 MeaB CLP1_P KTI12 AAA_30 DnaB_C Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 936896
NCBI-ProteinID: NP_391506
Pasteur: BG12508
BSORF: BG12508
UniProt: P96716
Position
complement(3731822..3732535)
Genome map
AA seq 237 aa AA seqDB search
MALRKNRGSRMQRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKS
TTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLENTVGLTSVLLKKSSMEQAVQASNE
KHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQILGNVADG
SVLVISSGKTEKEQAAKAKEALATCKSKLLGAIMNGKKLSKHSEYGYYGTKDNFMQK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcttagaaaaaacagaggctcgcggatgcagagaaatgtcattgcaatgacagag
ccgaaatccttgaactctgaacaatatcggacgattcgcacgaatatagaatttgcttca
gtggaccggcaaatgaaatcagtcatgattacatcggcttgtccgggggaaggaaaatca
acaacggccgccaacctggctgtcgtattcgcccaacagggaaaaaaagtgctcctgatt
gatgctgatttgcgaaaaccaacagtacatacggctttttttcttgaaaatacggttggc
ttaacatctgttttattaaagaaaagctctatggagcaggctgtacaagcatcgaatgaa
aaacatcttgacgtgctgacgagcggcccgatcccgccaaacccggccgagcttctctcc
tcgaagtggatgaaggagcttgcatacgaagcgtgtgcggcatatgatatggtcattttt
gatacgccgcctattcttgccgtagcagatgcacagattttaggcaacgtggcagacggt
tctgttctggttatttcaagcgggaaaacagaaaaagaacaagccgcaaaagcgaaagag
gcgcttgcaacgtgcaaaagcaagctccttggggcgattatgaacggcaaaaagctttcg
aagcactctgaatacggatattacggaaccaaggacaatttcatgcaaaaataa

DBGET integrated database retrieval system