KEGG   Bacillus subtilis subsp. subtilis 168: BSU36260Help
Entry
BSU36260          CDS       T00010                                 

Gene name
ywqC
Definition
(RefSeq) capsular polysaccharide biosynthesis protein YwqC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR DUF155 Lys_export
Motif
Other DBs
NCBI-GeneID: 936897
NCBI-ProteinID: NP_391507
Pasteur: BG12507
BSORF: BG12507
UniProt: P96715
Position
complement(3732525..3733271)
Genome map
AA seq 248 aa AA seqDB search
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERK
EVQFNDVQTNLQLINTYNVIIKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNI
SVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKAEVSEHPSPVSPKPLLNIAIA
FAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEK
TGSGHFGA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatctacaagcttaaaagagatattatcaacgttaacaaaacgcatacttttg
attatgattgtaaccgcggctgccactgctgccggcggactcattagtttcttcgcactt
acacccatctatgaaaattcaactcagattctggtcaaccaatcgaaaaatgaacgaaaa
gaagtccaatttaacgatgtccaaaccaatcttcagttaatcaatacgtacaatgtcatc
attaagagccctgccatcttagatgaagtcattaaagaaatgggcctgtcgatgacatcc
caagaactgaatgacaaaattaccgtatccagcgaacaggactcccaagtggtcaacata
tcagtcagggatgaaaacgcggaaacagcggctcatattgccaatactatagcatctgtt
tttcaagacaaaatcacatccattatgaatgttgacaatgtcagcattctgtcaaaagcc
gaggtttcagaacacccgtcccctgtatcgccaaagccgctactaaacattgccatcgcg
tttgcggccggattggcgggaagcatcggactggccttcctgcttgagcatttggataat
acgatcaaatcggaagagcagctcgaatccttgctggacatacctgttttagggacagtt
tccaccattgcgaatgagcagaaaacagcaaagaccttacagggtttccaatctgaaaaa
acggggagtggacattttggcgcttag

DBGET integrated database retrieval system