KEGG   Bacillus subtilis subsp. subtilis 168: BSU36269Help
Entry
BSU36269          CDS       T00010                                 

Gene name
ywzD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303126
NCBI-ProteinID: YP_003097792
UniProt: C0H3S3
Position
complement(3733505..3733648)
Genome map
AA seq 47 aa AA seqDB search
MSEKKLNQEEFLKILMHAHEIGEQSSEMTTKEMLENLISHIKNGYAT
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaaattgaatcaagaagaatttctgaaaattttgatgcatgcacatgaa
attggtgagcagtcatctgagatgacgacgaaggaaatgcttgaaaatttgatttctcat
attaaaaatggatatgcaacataa

DBGET integrated database retrieval system