KEGG   Bacillus subtilis subsp. subtilis 168: BSU36280Help
Entry
BSU36280          CDS       T00010                                 

Gene name
ywqA
Definition
(RefSeq) ATP-dependent helicase YwqA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N DUF3670 Helicase_C ResIII ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 936906
NCBI-ProteinID: NP_391509
Pasteur: BG12505
BSORF: BG12505
UniProt: P94593
Position
3735449..3738217
Genome map
AA seq 922 aa AA seqDB search
MASLKEILIHVEQMEDGSFTLSAFDENEQPLPYSHMKKHLFQWHESSFYGTFLEDVSFIG
TTAVLLSPWMTVELLGKNSFNSFSSVQLTEETEPLIEAASTIYEFIADGDFMPDYDAWTN
GVFRWKDRDNILEGFTAEWFSAAVQDYIQYDDDLREKWEHIKEKSPAVTTFRGHFLDEED
FLEGIGWIDDQSPFTVGLRLNEPDFDGDEWKIEMFLRDKKSGAVEFFDGLKSLKKSWQAY
SDKIAREQDRFHRTVPWLSFDSGTTLISEEEAWIFLSEASETLVDMGVEILLPSWWQIVR
DSNMMLKAKVSSSPRGESFVGMNALLDFNWRFATNGIELTEAEFNELVASNRRLVNIRGQ
WVKIDPQFIKQMKRLMEKAESEGLHMSDILARELMDQQDGGLEDSDLIDTSAFAGIQFDL
SKQLRSLIRKLTAAENLPEHKVSPSFKGTLRPYQKYGMNWLLFLRESGFGACLADDMGLG
KTIQMIAYFLHVKESGRQKTPHLIIAPTSVLGNWQRELQTFAPDLSVALHYGPRRPKGDD
FAAHYENADVVLTSYGLSHADTEELSSVTWNTICLDEAQNIKNAHTKQSRAIRKLKGLHH
IALSGTPMENRLTELWSIFDFMNKGYLGSLTGFHKRYVLPIEKDRDEKRIGQLQQLIRPF
LLRRTKRDEEVALNLPEKLEEKEFIPLSAEQASLYEQLVKDTFDHMTSLTGMQRKALILS
MLGRLKQICDHPALYLKEEQTELLAGRSVKLEKLLELMTAIRAQNESCLIFTQYIQMGNM
MKRLLEKTFGEPVQFLNGSLSKQERDTLVEKFQRKEYPTLILSLKAGGTGLNLTAANHVI
HYDRWWNPAVENQATDRAYRIGQERFVHVHKMITTGTIEEKIDVMLESKQTLNDQIIQSE
NWITELSTQELEELFTLSATAQ
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcttaaagaaattctcatccacgtcgaacaaatggaagatgggtcatttacg
ctctcagcctttgatgagaatgagcagcctcttccctacagccatatgaaaaagcatttg
ttccaatggcatgaatcctcattttacggaacctttctagaggatgtcagcttcatcggg
acgactgctgtccttctatctccatggatgactgtagagcttctcggcaaaaactcgttc
aactcattcagctccgtgcagcttacagaagaaacggagccgctgatcgaggcggcatcg
accatctatgaatttatcgcggacggcgattttatgcctgactatgacgcatggacaaac
ggtgtttttcgctggaaggaccgcgataatatactggaaggctttactgcggaatggttt
tccgctgccgtacaggattacatccagtacgacgatgacctgcgggagaaatgggaacat
atcaaggaaaaatcgcctgcggttacgacattccgtggccattttcttgatgaagaggat
tttctggaaggcattggctggattgacgatcaatctccatttactgtcggcttgcgctta
aatgaaccggactttgacggagacgaatggaagatcgagatgtttttacgcgataaaaag
agcggtgctgtagaattctttgacggactgaagagcctcaaaaaatcgtggcaggcgtac
agcgataaaatcgcgcgtgagcaggaccgctttcacagaacggttccgtggctgtcgttt
gattccgggacaacgctgatctcggaggaagaagcctggatcttcctgtcagaagcaagt
gagacgcttgtcgatatgggggtagaaatcctcctgccgtcctggtggcagattgtcaga
gacagcaacatgatgctgaaagcaaaggtgtcttcctccccgcgcggcgagtcatttgtc
ggcatgaatgcactgcttgatttcaactggcggtttgcgacaaatggaattgaactgact
gaggctgaatttaatgagcttgtcgccagcaacaggcgccttgttaatatccgcgggcaa
tgggttaaaatcgatccgcagtttatcaaacagatgaaacgcctgatggaaaaagcagaa
tcagagggactccacatgtctgatattctggcgcgggagctaatggatcagcaggatggc
ggacttgaggattcggacctgattgatacatctgcttttgccggcattcagtttgatctg
tctaaacagctcaggtcactgattcgaaagctcactgccgcggaaaacctgccggagcac
aaagtcagtccttctttcaaaggaacgctccgcccttatcagaaatacggcatgaactgg
ctgctgtttctgcgggaaagcggttttggcgcctgtctggctgacgatatggggcttggg
aaaacgattcaaatgatcgcctatttccttcacgtgaaggaaagcggccgacaaaaaacg
cctcatttgattattgcgccgacatccgtacttggcaactggcagcgggagcttcaaacc
tttgcccctgatctgtctgtcgcgctccattatgggccgcgccggccaaagggtgatgat
ttcgccgcgcattatgaaaacgcagacgtggtgctcacttcatacggtctgtcacatgcc
gatactgaagagctttcttctgtgacatggaacacgatctgccttgatgaagcgcaaaat
attaaaaacgcgcatacgaagcaatcacgcgcaatcaggaagctgaaggggcttcaccat
atcgcgctgagcggcacgccgatggaaaaccgactgactgagctgtggtctatttttgac
ttcatgaataaaggctacctcggcagtttgaccggcttccataaacgctatgtgctgccg
atcgaaaaagaccgggacgaaaagagaatcggacagcttcagcaattaatccggccattc
cttctccgccggacgaaacgggatgaagaggtcgcgcttaatcttcctgagaagctggaa
gaaaaagaatttatccctctgtcagccgagcaggcatccctttatgagcagctcgtcaaa
gacacttttgaccatatgacatccctgaccggcatgcagcgaaaagcgctgatcctcagc
atgcttggacggctcaagcaaatatgcgatcatcccgcgctttatttaaaggaagagcaa
accgagctgctggccggcagatcagtcaagctcgaaaaattgctggaactgatgacagcg
atccgcgcccaaaacgaaagctgcctgattttcacgcaatacattcagatggggaacatg
atgaagcggctgcttgaaaaaacgttcggggaacctgtgcaatttttaaatgggagtctc
tccaagcaagagcgggatacactcgttgagaaatttcaaaggaaagaatatccgacactg
attctttcactcaaagctggaggcaccggacttaatttgaccgccgccaatcacgtcatc
cattatgacagatggtggaacccggcggttgaaaatcaagcgactgaccgtgcataccgc
ataggccaggagcgctttgtccacgttcataaaatgattacgacaggaacaatcgaagaa
aaaattgatgtcatgcttgaatccaagcaaaccctgaacgatcaaattatccaaagtgaa
aactggattaccgagctttccacacaggagctcgaagaattgtttacattaagcgctaca
gcgcaataa

DBGET integrated database retrieval system