KEGG   Bacillus subtilis subsp. subtilis 168: BSU36290Help
Entry
BSU36290          CDS       T00010                                 

Gene name
ywpJ
Definition
(RefSeq) phosphatase YwpJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD Trehalose_PPase Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 936907
NCBI-ProteinID: NP_391510
Pasteur: BG12504
BSORF: BG12504
UniProt: P94592
Structure
PDB: 

Position
complement(3738343..3739200)
Genome map
AA seq 285 aa AA seqDB search
MKLIAIDLDGTLLNSKHQVSLENENALRQAQRDGIEVVVSTGRAHFDVMSIFEPLGIKTW
VISANGAVIHDPEGRLYHHETIDKKRAYDILSWLESENYYYEVFTGSAIYTPQNGRELLD
VELDRFRSANPEADLSVLKQAAEVQYSQSGFAYINSFQELFEADEPIDFYNILGFSFFKE
KLEAGWKRYEHAEDLTLVSSAEHNFELSSRKASKGQALKRLAKQLNIPLEETAAVGDSLN
DKSMLEAAGKGVAMGNAREDIKSIADAVTLTNDEHGVAHMMKHLL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaattgcgattgacttagatggaaccttactcaacagcaagcatcaggtaagc
ttggaaaatgaaaacgcactgcggcaggcgcagcgggacggcattgaagtggtggtgtca
actgggcgcgctcattttgacgtcatgtcaatctttgaaccgctggggatcaaaacatgg
gtcatcagtgcaaacggcgccgtcattcacgatcccgagggcaggctttatcatcacgaa
acgattgataagaaacgggcgtatgacattctctcatggcttgagtcggaaaactattat
tatgaggtattcacaggttcagcgatttatacgccgcaaaacggcagagaacttcttgat
gttgagctcgacagattcagaagcgcaaatccggaagcggatctttctgtccttaagcag
gcggccgaggtgcaatacagccaatcgggctttgcttacattaactcctttcaagagctg
tttgaagccgatgagccaatcgatttttacaatattctcggcttttctttcttcaaagaa
aagcttgaggcaggctggaaaagatatgagcatgccgaagatttgacgcttgtcagttcg
gctgagcacaactttgagctttcttcccgcaaagcttccaaggggcaggcgctgaagagg
cttgcaaaacagctgaatattccgctcgaggaaactgctgctgtaggtgacagtttaaat
gacaaatcgatgctggaggctgcgggaaaaggtgtagcgatgggcaatgcccgggaagac
atcaaatcgatagccgatgctgtcaccttaaccaatgacgaacacggtgtcgcacatatg
atgaaacatttgttgtaa

DBGET integrated database retrieval system