KEGG   Bacillus subtilis subsp. subtilis 168: BSU36300Help
Entry
BSU36300          CDS       T00010                                 

Gene name
glcR
Definition
(RefSeq) HTH-type transcriptional repressor GlcR
  KO
K22103  DeoR family transcriptional regulator, carbon catabolite repression regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU36300 (glcR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    BSU36300 (glcR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 HTH_23 HTH_20 Cpn10 Phage_rep_O GntR Replic_Relax HTH_17 AA_synth MarR MarR_2 TFIIE_alpha DUF977 HTH_Crp_2 DUF1670 HTH_IclR HTH_36 FaeA
Motif
Other DBs
NCBI-GeneID: 936908
NCBI-ProteinID: NP_391511
Pasteur: BG12503
BSORF: BG12503
UniProt: P94591
Position
complement(3739206..3739982)
Genome map
AA seq 258 aa AA seqDB search
MYQEERLVAILDFLKQHNRITTEQICTLLQVSRDTARRDLVKLEEQNAIIRTRGGAILPT
VHQKIQSYSGRLKTVSEEKNKIGRLAASLIHDGDRVILDASTTVQACAKHLNAVDCTVIT
NSINLADVLSDKEGIEIYLLGGKLEKEHRFLYGSSVIEKLSSYHVDKALIGVVGISEHGI
TIAHEEDGMVKRKMIQQAKQVIALADHSKLGSTSFYQYAELNEIDLLITDRLPNQAFCDL
LDRNGVELLVTEQDEGKD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccaagaagaaagattagtagcgattttggattttttaaaacagcataaccgaatt
acaacggagcagatctgtacgctcctgcaagtgtcaagggatacagcgcgacgagatctt
gtgaaacttgaggaacagaatgccatcatccgcacaagaggcggcgccattttaccgact
gtgcatcagaaaattcaaagctattccggccgcctgaaaacagtgtctgaggaaaaaaat
aagatcggcaggcttgcagcatcgcttattcatgatggagaccgggtgattttagacgcc
tctacaactgttcaggcatgtgcaaagcatttgaatgcggttgattgtaccgtaatcacc
aattcgattaatcttgcggatgtgctgtccgataaagagggaattgaaatttatctgctg
ggaggcaagctggaaaaggagcaccgctttctgtacgggtcctctgtgattgaaaagctc
tcaagctaccatgttgataaagcgctgattggtgtggtcggcatttccgaacatggcatt
acaattgcgcatgaagaggatggcatggtgaagcggaaaatgatacagcaggcaaagcag
gtaattgcgcttgcagaccattctaagctgggcagcaccagtttttatcagtatgcggag
ctgaatgaaatcgacctcttgattacagacaggctgccgaatcaggcattttgtgacttg
cttgaccgaaacggcgttgagcttctcgtgacagagcaggatgaaggaaaggactga

DBGET integrated database retrieval system