KEGG   Bacillus subtilis subsp. subtilis 168: BSU36310Help
Entry
BSU36310          CDS       T00010                                 

Gene name
ssbB
Definition
(RefSeq) single-stranded DNA-binding protein SsbB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 936910
NCBI-ProteinID: NP_391512
Pasteur: BG12502
BSORF: BG12502
UniProt: C0SPB6
Structure
PDB: 

Position
complement(3740206..3740547)
Genome map
AA seq 113 aa AA seqDB search
MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAEN
TALYCQKGSLVGVSGRIQTRSYENEEGVNVYVTEVLADTVRFMDPKPREKAAD
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatcaggtcatgcttgtcggacgtcttacaaaagatcctgatcttcgctacact
tccgccggtgcggcagttgcacatgttacgctcgcggtgaaccgcagcttcaagaatgct
tcaggtgaaatcgaagctgattacgtcaattgcacactttggagaaaaacagctgaaaac
acggcgttgtattgccaaaaaggttctctcgtcggcgtaagcggacggattcagacaaga
agctatgaaaacgaggaaggcgttaacgtgtatgtaacagaagtgttggctgacactgtt
cgttttatggaccctaaaccccgggaaaaagctgctgattga

DBGET integrated database retrieval system