KEGG   Bacillus subtilis subsp. subtilis 168: BSU36320Help
Entry
BSU36320          CDS       T00010                                 

Gene name
ywpG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lectin_like
Motif
Other DBs
NCBI-GeneID: 936912
NCBI-ProteinID: NP_391513
Pasteur: BG12501
BSORF: BG12501
UniProt: P94589
Position
complement(3740624..3741007)
Genome map
AA seq 127 aa AA seqDB search
MNQFRLKEIYIDGVPSESHLIQKEVTYMLSRKEVFEVHLNKKGRISFLYETQDGMEQYKI
KLSMPEKKLSFQWFAWDGSSYVRMNTQNWLTKQIFFRFLKSTYFFKGKKQKMFLAEGKMK
TKDKNRG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttcgtttaaaagaaatttatattgacggcgttccttctgaaagtcatttg
attcaaaaggaagtaacatatatgttaagccgtaaagaagtgtttgaggttcatctgaac
aaaaaaggaagaataagttttttatacgaaacacaagatggcatggagcagtataaaatc
aagctgtcaatgccggaaaaaaaattgagctttcagtggtttgcgtgggatggctcttcc
tatgtgcgcatgaatacgcaaaactggctgacaaagcaaatctttttccgttttttaaaa
agtacatatttcttcaaaggaaaaaagcaaaagatgtttttagctgaaggaaaaatgaaa
acgaaagataaaaacagaggctga

DBGET integrated database retrieval system