KEGG   Bacillus subtilis subsp. subtilis 168: BSU36330Help
Entry
BSU36330          CDS       T00010                                 

Gene name
ywpF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YwpF UvrA_inter
Motif
Other DBs
NCBI-GeneID: 936915
NCBI-ProteinID: NP_391514
Pasteur: BG12500
BSORF: BG12500
UniProt: P94588
Position
3741182..3741592
Genome map
AA seq 136 aa AA seqDB search
MKTFKLVDLNVERVDKEEQSIEQFPLIDGLIINKEDGENHWLIEALVQKEHLSFFEQLQN
SQSEAKVFVTITKKSNRPAQLTAAVKNIVKLEESIQVLLYGQMVTRKQQGTETILESLVK
EGYTGTKLIEAFKQKL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttaaactggttgacctgaatgtggaacgagtggacaaggaagaacaatca
attgaacagtttccccttattgacggactgattataaataaagaagacggtgaaaatcac
tggctgattgaggcgcttgtacagaaagaacatctgtctttttttgaacagcttcaaaac
agccaatctgaagccaaagtatttgtaacgatcacgaaaaaaagcaatcgccccgcccag
ctgacagcagcagtgaaaaatatcgtcaagctggaagaaagcattcaggttttactctac
ggacaaatggtcacaagaaaacagcagggcactgaaaccattctcgagtcccttgtaaaa
gagggctatacaggaacaaaactcattgaggcatttaagcaaaaattataa

DBGET integrated database retrieval system