KEGG   Bacillus subtilis subsp. subtilis 168: BSU36340
Entry
BSU36340          CDS       T00010                                 

Symbol
ywpE
Name
(RefSeq) sortase
  KO
K07284  sortase A [EC:3.4.22.70]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU36340 (ywpE)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU36340 (ywpE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.70  sortase A
     BSU36340 (ywpE)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C60
   BSU36340 (ywpE)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Sortase
   BSU36340 (ywpE)
SSDB
Motif
Pfam: Sortase Ribosomal_L9_C RTT107_BRCT_5
Other DBs
NCBI-GeneID: 936904
NCBI-ProteinID: NP_391515
Pasteur: BG12499
BSORF: BG12499
UniProt: P94587
Position
complement(3741732..3742040)
AA seq 102 aa
MRRDQKMGEGNYPLAGHHLKQKNLLFGPLENIKTGAQIVITDFKKDYIYSVTSKDIISEM
DADVVEETNKKEITLITCDKAVKTEGRLVVKGELVDSFGHTN
NT seq 309 nt   +upstreamnt  +downstreamnt
atgcgccgggatcaaaaaatgggtgagggaaattatccgttggcgggccatcatttgaag
caaaagaatcttctgttcggacctctggaaaacataaaaacaggtgcccaaattgtcatc
acggattttaaaaaggattatatctattctgtaacatcgaaagacatcatatcggaaatg
gatgcagatgtagttgaggagacaaacaaaaaggagattacgttaatcacatgtgacaag
gcggtcaaaaccgaagggcgcctcgttgtgaaaggggaattggttgattcttttggccat
acaaattaa

DBGET integrated database retrieval system