KEGG   Bacillus subtilis subsp. subtilis 168: BSU36350Help
Entry
BSU36350          CDS       T00010                                 

Gene name
ywpD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_kinase HATPase_c Response_reg HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 936914
NCBI-ProteinID: NP_391516
Pasteur: BG12498
BSORF: BG12498
UniProt: P94586
Position
3742384..3743220
Genome map
AA seq 278 aa AA seqDB search
MKIRERFSMVDLPVLIITAAIIGHDKYKAFHAGANDILQKPYHYSEFMARIQNLIMMKHT
ANQATRMEMAFLQSQIKPHFLYNVLNTIISLTHLDIEKAREVTEEFTNYLRMSFDFQNTS
AISSFRHELSIINSYLSIEKTRFSNRLEVLFDIDEDIDFILPPLMIQPLVENAVLHGVSK
KRGGGWIKLTAKKQSKNEYHIKVEDNGPGITPEKQIDLLSTDFDRSVGLKNINQRLKHFC
GSELMISSTPDAGTSVSMLIHLAETTGSPKELKDTERT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgcgaacgattcagcatggttgatcttccggttctgatcattacagctgcc
attatcggccatgacaaatacaaggcttttcatgccggagcgaatgacattttgcaaaaa
ccctatcattactctgaatttatggcgcgtattcaaaacctgataatgatgaaacataca
gcaaatcaagccacaagaatggaaatggcgtttctccagtcgcaaatcaagcctcatttt
ctttataatgtattaaacacgattatttctctcactcatttggatattgaaaaggcccgg
gaggtaacagaggaatttaccaactatttaagaatgagttttgactttcaaaatacatca
gccatcagttccttcagacatgagctttcgattatcaattcctatctttctatagaaaag
acgcgattcagtaatcggcttgaggttcttttcgatatagatgaagacattgactttatc
cttccgcctttaatgattcagcccttggtggaaaatgccgttcttcacggtgtcagcaag
aaaagaggcggaggatggatcaaactgacagctaaaaaacaaagcaaaaatgagtatcac
atcaaagtagaggataacggtcccgggataactccggaaaaacaaatagatctcttatca
acggattttgatcgcagcgtcggattgaaaaatatcaatcagcggctgaaacatttttgc
ggaagcgagttgatgatcagcagcactccggatgcaggcacctctgtctcaatgctcatt
catctcgctgaaacaacaggaagccctaaagaactgaaggacacagaacgaacctaa

DBGET integrated database retrieval system