KEGG   Bacillus subtilis subsp. subtilis 168: BSU36360Help
Entry
BSU36360          CDS       T00010                                 

Gene name
mscL
Definition
(RefSeq) large-conductance mechanosensitive channel
  KO
K03282  large conductance mechanosensitive channel
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36360 (mscL)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU36360 (mscL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscL UPF0239 TMEM154
Motif
Other DBs
NCBI-GeneID: 936909
NCBI-ProteinID: NP_391517
Pasteur: BG12497
BSORF: BG12497
UniProt: P94585
Position
complement(3743267..3743659)
Genome map
AA seq 130 aa AA seqDB search
MWNEFKAFAMRGNIVDLAIGVVIGGAFGKIVTSLVNDIIMPLVGLLLGGLDFSGLSFTFG
DAVVKYGSFIQTIVNFLIISFSIFIVIRTLNGLRRKKEAEEEAAEEAVDAQEELLKEIRD
LLKQQAKSPE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatgaatttaaagcctttgccatgcgggggaatatcgtagaccttgcgattggt
gttgtgataggcggcgctttcggaaagatcgtcacatctctagtaaatgatatcattatg
cctttggtcggtttgctgctgggagggcttgacttttcaggcctgtcgtttacgtttggc
gatgctgtagtgaaatatggcagctttatacagacgattgtgaacttcttaattatatcg
ttctccatttttatcgtcattcggactttgaatgggttaaggcgcaaaaaagaagcagaa
gaagaggctgcggaggaagcggtggatgcgcaggaggagctgctgaaagaaatcagagac
ctgctgaagcagcaagcaaagtcgccggaataa

DBGET integrated database retrieval system