KEGG   Bacillus subtilis subsp. subtilis 168: BSU36370Help
Entry
BSU36370          CDS       T00010                                 

Gene name
fabZ
Definition
(RefSeq) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01212  Fatty acid metabolism
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU36370 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU36370 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU36370 (fabZ)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BSU36370 (fabZ)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU36370 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-GeneID: 936918
NCBI-ProteinID: NP_391518
Pasteur: BG12496
BSORF: BG12496
UniProt: P94584
Position
complement(3743732..3744157)
Genome map
AA seq 141 aa AA seqDB search
MLDTQQIKEIIPHRYPFLLVDRITEVEEGKRAKGYKNVTANEEFFNGHFPQYPVMPGVLI
VEALAQVGAVAMLIKEENRGRLAFFAGIDNCRFKKQVKPGDQLHLEVEIIRARGTIGRGK
GVATVDGEVVCEVELTFALGE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatactcagcaaattaaagaaattattcctcaccgttatccgtttttgcttgtg
gatcggattacggaagttgaagagggcaaacgggcaaaaggctataaaaatgtaaccgct
aatgaagagttctttaacggacattttcctcagtacccggttatgcccggcgtattaatc
gtagaagcactcgctcaagtcggagctgttgcgatgttgattaaagaagaaaaccgcggc
agactggctttttttgcaggcattgataactgccgctttaaaaaacaagtcaagcctggt
gaccagcttcaccttgaggttgaaatcattcgtgcccgcggcacaatcgggcgcggaaaa
ggcgttgccacagttgatggcgaagtcgtttgcgaagtagaactgacttttgccctcgga
gaataa

DBGET integrated database retrieval system