KEGG   Bacillus subtilis subsp. subtilis 168: BSU36380Help
Entry
BSU36380          CDS       T00010                                 

Gene name
rapD
Definition
(RefSeq) response regulator aspartate phosphatase D
  KO
K06362  response regulator aspartate phosphatase D [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU36380 (rapD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU36380 (rapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RapH_N TPR_12 TPR_19 TPR_2 TPR_10 TPR_8 TPR_16 TPR_1 SNAP TPR_MalT ANAPC3 tRNA-Thr_ED RPN7
Motif
Other DBs
NCBI-GeneID: 936919
NCBI-ProteinID: NP_391519
Pasteur: BG11967
BSORF: BG11967
UniProt: P94583
Position
3744349..3745413
Genome map
AA seq 354 aa AA seqDB search
MISKFIEKRMLNMLDEWYSAMSKRKMNHVCTLKEKIDQHLPKIKKNTKLWMRYQLFQARH
QLLFENQNGLDSLFDGLYGLEDKMDDELKYYLYFFSGLYEMVKTAPKHAVHHFKKAEQYL
AAIHNTFEAADLYYQTAGAYYLMKSPPLSVQYVKKALHIYLHQFGYIKKVITCKLLLAVN
YIDQERYEKAEQLFKEIIKKTQQLHDENLLCHAYYNLGFLKATEKKDQEALLYFRKVLKN
QEFEMNSPVSYLHCVYESVRALFKTGNITEAKAVLQKGKELSEKVDIQTIYLKLKTLEAL
YTSAEDPYEQLLEYVLELEKIEAWVDLEVLLEDITEYYKKKDDFEKAAFFIMRG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgaagtttattgaaaaaagaatgctaaacatgttagacgagtggtattccgca
atgagcaaacgcaaaatgaatcacgtttgcacactgaaagagaaaattgatcagcacctt
ccaaagatcaaaaagaacacaaaactttggatgcgttatcaattgtttcaggcccgccat
cagctgctttttgaaaaccagaacggactcgattcattgttcgatggcctatatggcctg
gaagacaaaatggatgatgaattgaaatattatctgtattttttctctgggttatatgag
atggtaaaaacagctccgaaacatgcagtacatcattttaaaaaagctgaacagtacctg
gccgccattcacaatacgtttgaagccgctgatttatattatcaaaccgccggcgcctat
tacttgatgaaatcaccgccgctttccgtccaatacgtcaaaaaagcattacacatctat
ttgcaccaattcggctatatcaaaaaggtaatcacctgtaaacttttgctcgccgtgaat
tatattgatcaagaacgctatgaaaaagctgaacagcttttcaaagaaatcattaagaaa
acccagcaactacatgacgaaaacctgctatgccacgcttattataaccttggcttttta
aaagcgaccgagaaaaaagaccaggaagcgcttctttactttagaaaagtattaaagaat
caagaatttgaaatgaattcaccagtctcatatcttcattgtgtgtacgagtctgtcaga
gcgctttttaaaacagggaacatcacagaagctaaagccgtccttcaaaaaggaaaagaa
ttatctgaaaaggtagacattcaaaccatttatttaaaattaaaaacgcttgaagccctc
tacacatcagccgaagacccttatgagcagctgctcgaatatgtgcttgaattagaaaaa
atcgaggcgtgggtggatttagaagtgctgttagaagatattacggaatactacaaaaaa
aaggacgatttcgaaaaagccgctttttttatcatgcgcggctga

DBGET integrated database retrieval system