KEGG   Bacillus subtilis subsp. subtilis 168: BSU36400Help
Entry
BSU36400          CDS       T00010                                 

Gene name
flhO
Definition
(RefSeq) flagellar hook-basal body complex protein FlhO
  KO
K02392  flagellar basal-body rod protein FlgG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU36400 (flhO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU36400 (flhO)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BSU36400 (flhO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod
Motif
Other DBs
NCBI-GeneID: 936927
NCBI-ProteinID: NP_391521
Pasteur: BG10917
BSORF: BG10917
UniProt: P39752
Position
complement(3746279..3747091)
Genome map
AA seq 270 aa AA seqDB search
MLKGLYTATSAMIAQQRRTEMLSNNIANANTSGYKADQGSMRAFPEMLLSRIESKSPAGT
SRTEIGSVNTGVYMQELKPLFTQGSLKSTDQPTDIALIENQVPMSAETNEKAALFYPVQT
ADGIRYSKSSTFSLNENNQLTINGRPILSTDRQPITVDNENFTVSENGTVTTNGRTAGQI
DVRMAEDVRNLKRDGNDLYSTADGNDLPSAAGNNQVAYSLKQGVSELSNVDVTSAYTEMT
EAYRSFEANQKVIQAYDKSMDKAANEIGKI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaaaggattatatacagcaacatccgcaatgattgcccagcagcgaagaacggaa
atgctttcaaataatattgctaacgcaaatacatcaggatataaagctgatcaaggctct
atgcgcgcgttccctgagatgctgctcagcagaatagaatcaaaatctccggccgggaca
tcaaggacggaaatcggttccgtgaataccggagtatatatgcaggagctcaagcctctc
tttacacagggaagcctgaagtccacagaccagcctacagacattgcattgatcgaaaat
caagttccgatgagtgcggaaaccaatgaaaaagctgctcttttttatccggttcaaaca
gcggatggaatccgttattcaaaaagcagcacattttcactaaatgagaacaatcagctg
acgatcaacggacgccctattttatcgacggatcgccagccaatcactgttgataatgag
aatttcactgtgtctgaaaacggtactgtgacaacgaacggacgcacagccggccagatt
gatgtcagaatggcggaagatgtccgcaatctcaaacgggacggaaatgatttgtacagc
acggcggacggtaatgatctgccaagcgcagccggaaataatcaggtagcctattcatta
aaacaaggcgtctcagagctttcaaacgtggatgtgacaagcgcctatacagaaatgact
gaagcgtacagatcgtttgaggcgaatcagaaggttattcaggcttacgataaaagtatg
gataaagcagcaaatgaaattggaaaaatttaa

DBGET integrated database retrieval system