KEGG   Bacillus subtilis subsp. subtilis 168: BSU36410Help
Entry
BSU36410          CDS       T00010                                 

Gene name
mbl
Definition
(RefSeq) MreB-like protein
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU36410 (mbl)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU36410 (mbl)
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU36410 (mbl)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU36410 (mbl)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    BSU36410 (mbl)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU36410 (mbl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreB_Mbl Actin HSP70 FtsA DDR PilM_2 EutA Ppx-GppA Hydantoinase_A FGGY_C
Motif
Other DBs
NCBI-GeneID: 936916
NCBI-ProteinID: NP_391522
Pasteur: BG10916
BSORF: BG10916
UniProt: P39751
Position
complement(3747254..3748255)
Genome map
AA seq 333 aa AA seqDB search
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVALDKNSGKVLAVGEEARRMVGRTPGNIV
AIRPLKDGVIADFEVTEAMLKHFINKLNVKGLFSKPRMLICCPTNITSVEQKAIKEAAEK
SGGKHVYLEEEPKVAAIGAGMEIFQPSGNMVVDIGGGTTDIAVISMGDIVTSSSIKMAGD
KFDMEILNYIKREYKLLIGERTAEDIKIKVATVFPDARHEEISIRGRDMVSGLPRTITVN
SKEVEEALRESVAVIVQAAKQVLERTPPELSADIIDRGVIITGGGALLNGLDQLLAEELK
VPVLVAENPMDCVAIGTGVMLDNMDKLPKRKLS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaagggatattggtattgacctcggtactgcaaatgtactgatccatgttaaa
ggtaaaggaattgttctgaatgaaccttccgttgttgcacttgataaaaacagcggcaaa
gtgctggcggttggcgaagaggcaagacgaatggttggacgtacacctgggaatattgtt
gcgattcgcccgctgaaagacggagttattgctgactttgaagtaacagaagcaatgctg
aaacattttattaacaagctgaatgtaaaaggcctgttctcaaagccgcgcatgctcatt
tgctgcccgacgaatattacatccgttgagcaaaaagcaattaaagaagctgcagaaaaa
agcggcgggaaacatgtgtaccttgaagaagaacctaaagttgccgctatcggcgcgggt
atggaaatattccagccaagcggtaacatggttgtagacatcggaggcgggacgacggat
atcgcggttatttcaatgggcgatattgtcacctcctcttctattaaaatggctggggac
aagtttgacatggaaatcttaaattatatcaaacgcgagtacaagctgctgatcggcgaa
cgtactgcggaggatattaagattaaagtcgcaactgttttcccagacgcacgtcacgag
gaaatttccattcgcggacgggacatggtttccggtcttccaagaacaattacagtaaac
agtaaagaagttgaagaagcccttcgtgaatctgtcgctgttattgttcaggctgcaaaa
caagtgctcgaaagaacaccgcctgaactttctgctgatattattgaccgcggcgttatt
attaccggcggaggcgcgctcttaaacggccttgaccagctgcttgctgaagagctgaag
gtaccggtcctcgttgctgaaaatcctatggattgcgtagccatcggcacaggtgtcatg
cttgataatatggacaagcttcctaaacgcaaactaagctga

DBGET integrated database retrieval system