KEGG   Bacillus subtilis subsp. subtilis 168: BSU36420Help
Entry
BSU36420          CDS       T00010                                 

Gene name
spoIIID
Definition
(RefSeq) stage III sporulation protein D
  KO
K06283  putative DeoR family transcriptional regulator, stage III sporulation protein D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU36420 (spoIIID)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    BSU36420 (spoIIID)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIID HTH_38 HTH_23 HTH_11 HTH_10 HTH_7 HTH_22 HTH_DeoR HTH_50 LZ_Tnp_IS481 HTH_Tnp_ISL3 CENP-B_N HTH_40 HTH_28 LacI Mga HTH_Tnp_4 GntR HTH_IclR HTH_5 MarR_2
Motif
Other DBs
NCBI-GeneID: 936917
NCBI-ProteinID: NP_391523
Pasteur: BG10408
BSORF: BG10408
UniProt: P15281
Structure
PDB: 

Position
complement(3748421..3748702)
Genome map
AA seq 93 aa AA seqDB search
MHDYIKERTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEIL
DYHKSIRHLRGGEATKLKYKKDEILEGEPVQQS
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgattacatcaaagagcgaacaatcaagatagggaagtacatcgtggagacaaag
aaaaccgttcgtgtcattgcgaaggaatttggtgtttccaaaagtacagtacacaaggat
ttaacagagcgtctgcctgaaattaaccccgacttggcaaacgaagtgaaagaaatactc
gattatcataaatccatcaggcatttaagaggaggagaagcgacaaagctcaaatataaa
aaagatgaaattctcgaaggagagcctgttcagcaatcgtaa

DBGET integrated database retrieval system