KEGG   Bacillus subtilis subsp. subtilis 168: BSU36430Help
Entry
BSU36430          CDS       T00010                                 

Gene name
usd
Definition
(RefSeq) protein usd
  KO
K06435  required for translation of spoIIID
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU36430 (usd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 938188
NCBI-ProteinID: NP_391524
Pasteur: BG11984
BSORF: BG11984
UniProt: O32276
Position
complement(3748717..3748827)
Genome map
AA seq 36 aa AA seqDB search
MGIFHKLTFKTIQRRSGIMNDSLQNTDLISHFSHPF
NT seq 111 nt NT seq  +upstreamnt  +downstreamnt
gtgggcatatttcacaaacttacttttaaaaccatacaacgaagaagcggcataatgaac
gactctttacagaatacggatctcatttcacacttctcacatccattttag

DBGET integrated database retrieval system