KEGG   Bacillus subtilis subsp. subtilis 168: BSU36440Help
Entry
BSU36440          CDS       T00010                                 

Gene name
ywoH
Definition
(RefSeq) HTH-type transcriptional regulator YwoH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 TrmB HTH_Crp_2 Fe_dep_repress GntR Penicillinase_R HTH_24 HTH_11 HTH_5 HTH_IclR Rrf2 HTH_36 SMC_ScpB CTK3_C Tfb2 DUF2250 DUF3116 Crp DUF501 POTRA_TamA_1 B-block_TFIIIC
Motif
Other DBs
NCBI-GeneID: 936923
NCBI-ProteinID: NP_391525
Pasteur: BG12495
BSORF: BG12495
UniProt: P94578
Position
3749052..3749465
Genome map
AA seq 137 aa AA seqDB search
MSYVNRHLIHQINQSARLIAKKANEQLEPFGLYSSQWSVLYCLRTIGPMTQKEIWSYLNV
EAPTVTRTIKRLEENGWVQRRQGEDKREKLVVLTKEAEKKYEEINVKMLKFEEELLADFR
DEDKEAFSHLFRMFLQQ
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgtcaacagacacctcattcatcaaatcaaccaaagcgcccgcctgattgcc
aagaaagccaatgaacagctagagccattcggcctttattcatctcaatggtcagtttta
tattgtttgcgtacgatcggaccaatgactcaaaaagagatttggtcctatttaaatgtg
gaagcgccgactgtgactcggacgatcaaacgcctggaggagaacggctgggttcagaga
cggcaaggtgaagacaaacgggaaaaacttgttgtcctcacaaaagaagccgagaaaaaa
tacgaagaaatcaatgtgaaaatgttgaaattcgaggaagagctgcttgcagatttccgg
gatgaagataaagaagctttttctcatttattccgcatgtttttacaacaatga

DBGET integrated database retrieval system