KEGG   Bacillus subtilis subsp. subtilis 168: BSU36450
Entry
BSU36450          CDS       T00010                                 

Symbol
ywoG
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3 MFS_1_like MFS_2
Other DBs
NCBI-GeneID: 936928
NCBI-ProteinID: NP_391526
Pasteur: BG12494
BSORF: BG12494
UniProt: P94577 A0A6M3ZJW8
Position
3749487..3750677
AA seq 396 aa
MKKADAIWTKDFIMVLLVNLFVFVFFYTFLTVLPIYTLQELGGTESQGGLLISLFLLSAI
ITRPFSGAIVERFGKKRMAIVSMALFALSSFLYMPIHNFSLLLGLRFFQGIWFSILTTVT
GAIAADIIPAKRRGEGLGYFAMSMNLAMAIGPFLGLNLMRVVSFPVFFTAFALFMVAGLL
VSFLIKVPQSKDSGTTVFRFAFSDMFEKGALKIATVGLFISFCYSTVTSYLSVFAKSVDL
SDISGYFFVCFAVTMMIARPFTGKLFDKVGPGIVIYPSILIFSVGLCMLSFTHSGLMLLL
SGAVIGLGYGSIVPCMQTLAIQKSPAHRSGFATATFFTFFDSGIAVGSYVFGLFVASAGF
SAIYLTAGLFVLIALLLYTWSQKKPAEAEGKVSIAE
NT seq 1191 nt   +upstreamnt  +downstreamnt
ttgaaaaaagcggatgcgatatggaccaaggattttattatggtcctgcttgtcaattta
tttgtgtttgtgttcttttatacatttttaactgtattgccgatctatacactgcaagag
cttggcggcacagaatcacaaggcgggcttttaatcagcctgttccttctgtctgcgatc
attacacggcctttctccggagccatcgttgagcgtttcgggaagaaaagaatggcgatt
gtatcaatggcgctcttcgccctatcatcttttctgtatatgccgattcataacttttcc
ctgctgctcggattgcggttcttccaagggatttggttcagcattttaacgactgttaca
ggtgcaattgccgctgatattattccagccaaacggcgcggtgaagggcttggatacttt
gccatgtctatgaacctcgctatggcgatcgggcctttccttggcctgaatttgatgaga
gtggtaagctttcctgtattctttacagcctttgcgctgtttatggttgcgggcttactt
gtttcgttcttgataaaagtgccgcaaagtaaggacagcggcacgactgtattccgtttt
gcgttctcggatatgtttgaaaagggcgcactcaaaattgcgacggtcggtttgtttatt
tctttctgttattcaacagtcacatcatatctgtctgtattcgccaaatcagttgacctt
tcggatatcagcggatatttctttgtttgttttgcggtgacaatgatgattgcacgcccg
ttcacagggaaattgttcgacaaagtcggaccgggcattgtcatttatccatcaatcctg
attttctctgtcggactctgcatgctgtccttcacacatagcggcttaatgcttctgctt
tcaggggcggttatcggtcttggctacggatcaatcgttccttgcatgcaaacattggcg
attcagaaatctccggctcaccgctccggttttgcgacggcaacgttctttaccttcttt
gacagcggaattgctgtaggatcgtatgtattcggattgtttgtagcatctgccggcttc
tctgccatttatttaacagcggggctgttcgttttaattgctctgcttctctacacgtgg
agccagaaaaaacctgcagaggctgaaggaaaagtgtctattgcagaataa

DBGET integrated database retrieval system