KEGG   Bacillus subtilis subsp. subtilis 168: BSU36460
Entry
BSU36460          CDS       T00010                                 

Symbol
ywoF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Beta_helix DUF1565 NosD DUF5123
Other DBs
NCBI-GeneID: 936925
NCBI-ProteinID: NP_391527
Pasteur: BG12493
BSORF: BG12493
UniProt: P94576 A0A6M4JQ24
Position
complement(3750768..3752174)
AA seq 468 aa
MRKWYFILLAGVLTSVILAFVYDKTKANEEGSGDYLYVSPNGSDQNEGTKEKPFRTLAHA
SEKAAAGTTVMIREGTYHETLDVKHSGTDGKPITFRNYENENVVISGESVANAEYETPLI
RIHDKHDIAISGLTIQDLSVSSEEATAIGIYVSGSSSHIAIKDNHIRGIKTTADEGNAHG
IAVYGTGSMKDIRIEDNTVEKLTLGASEAVVLNGNIDGFTVAGNVVRNNNNIGIDLIGYE
GTADKNDYVRNGVVENNTVYQNSTYGNPAYGDEYSAGGIYVDGGHDIEIKNNTVYDNDIG
IEATSEHKGKYANAIQITDNKVYNNAYTGISIGGYDKKRGGTSNSLIARNIMYRNDTKGL
YGGQLLLQYDTKNNTIEKNILTAGDSRLFIGNDFTENEGNTVNHNVYHKEADQDGIWMWK
KKEYDSFSSYRKATKNDQQSIYADPMFRDEASYDFSLDPDSPARPVIE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgagaaaatggtattttattcttttggcgggtgttttaacgtctgtcatcctcgctttc
gtttatgataagacaaaagcgaatgaggaaggatctggggattatctgtatgtttcgcca
aatggcagtgatcaaaatgaaggaacaaaagaaaagccgtttcgtacattggcacacgca
tctgagaaggctgctgccggcacaactgtcatgattcgggagggcacgtatcatgagacc
cttgatgtaaagcacagcggtacggacggaaagcctatcacattccgaaactatgaaaat
gaaaacgtcgtgattagcggtgaatccgttgcgaacgctgaatatgaaacaccgcttatt
cgtattcacgataaacatgacattgccatcagcggtttaacaattcaagatctttctgtt
tcatctgaggaagcaactgctatagggatttatgtatcagggtccagcagtcatatcgcc
attaaggataatcacatccgggggattaagacaacagcggatgaaggaaatgctcacgga
atcgcagtttatgggactggcagcatgaaagacatccgaatcgaggacaatacagttgag
aaactgacgcttggagcgagtgaagcagttgtgctgaacggtaatatcgacggcttcaca
gttgcaggcaatgtggtccgcaacaataataacatcgggattgatctaattggttatgag
ggaaccgcggataaaaacgattacgtgcgaaacggagtcgtagaaaacaatacagtttat
caaaactcgacttacggcaatcctgcttatggagatgaatactcagcgggcgggatttat
gtcgatggaggacacgatatcgaaattaagaacaacacagtttacgataacgatattggg
attgaagcaacgtctgaacacaaaggaaagtatgcaaatgccattcagatcacagacaac
aaagtgtacaacaatgcgtacaccggtatttcaatcggaggatatgacaaaaagcggggc
ggcaccagcaattctctgattgcccgcaatattatgtaccggaatgacacaaagggactg
tacggcggacagctgctgctgcagtacgatacgaaaaacaacacaattgaaaagaatata
ttgacggccggtgattccagattatttatcggaaacgactttacagaaaacgaaggtaat
acggtcaatcataacgtgtaccacaaggaagcggatcaagacggcatatggatgtggaaa
aagaaagaatatgattcattttcttcgtatcgaaaagcaacaaaaaacgatcaacaatcc
atatatgccgatccgatgtttcgtgatgaagcgtcctatgatttttcgttagatcctgat
tcacctgcgcggcctgtcattgaataa

DBGET integrated database retrieval system