KEGG   Bacillus subtilis subsp. subtilis 168: BSU36480
Entry
BSU36480          CDS       T00010                                 

Symbol
ywoD
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12
Other DBs
NCBI-GeneID: 938533
NCBI-ProteinID: NP_391529
Pasteur: BG12491
BSORF: BG12491
UniProt: P94574 A0A6M3ZIV2
Position
complement(3753933..3755291)
AA seq 452 aa
MLSKKSRAVFLTAVASGTMLNPLNSSMISLALHSIQHEFHLSFTTVSWLISSFYLASAVA
QPVTGKLGDLIGRKRLFLFGLILVAVSAIGAPFAPTFMTLLVMRLFQSVGSSAIYPSGVG
LIRNHIHERQASALAVLSIFASAMTALGPTAGGFLIVWGGWPAIFIVNLPFIILSFLLGL
YMFPKDQKKGAGIKTIIRQLDILGIVLFAGGIIFLLSFLLSFSTSPHAVEGVLGLLLLCA
FVWRELKTDKPFIDVRLFKTQRNLSAVYVQFILLNVFFYCLFFGLPSYFQDEMHLSVQTS
GLFMLFMSGMSIVVSPLTGKWIDRSGVVKPIFAGALLMTAGAVLLTIFFINVQTIGKGLI
LSLLGIGYGLGNVALQAAMLETSPSNMVGTTSGLFQTCRYLGSILSSVILGILFGKEITA
AHFDMMGIIMIIAGGASLLMAVRFAALMKTAS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgttatcgaaaaaaagccgagctgtttttttaacagctgtggcttcgggaacaatgctg
aatccgctgaactcgtctatgatctctcttgcgctccatagcatccagcatgagtttcac
ctctcgtttacaacggtttcctggctgatttcctcgttttacttggcgagtgccgtagcg
cagcccgtaacgggaaagctcggtgatttgattgggcggaaacgcttgtttttattcggg
cttattcttgttgcggtttctgccatcggggcgccgtttgcgccgacgtttatgacatta
ttggtcatgcggctgtttcaatcggtggggagcagtgcgatttatccgtcaggtgtcggc
ttgattcggaatcatattcatgagcgccaagcttcagccttggctgtactctctattttt
gcgtccgccatgacggcgctggggccgacagccggcgggtttttgattgtatggggaggc
tggccggcgatctttatcgttaatttgccgtttattatcctcagcttcttattgggcctg
tatatgttcccgaaagatcagaaaaaaggggcaggaatcaaaaccattattcggcagctc
gatattcttggaattgttttatttgccgggggaatcattttccttctatcctttttgctg
tcgttcagcacgtcgccgcatgcggttgaaggtgtgcttggcttgcttctgctctgtgcg
tttgtctggcgcgagctgaaaacggataagccgtttattgatgtccgtctgtttaaaaca
cagcgaaacctgtcagccgtgtatgttcagtttattttattgaatgttttcttctattgt
ttattttttggtttgccaagttactttcaggatgaaatgcatctttctgttcaaacgagc
ggcctgtttatgctgtttatgtctggaatgagcatcgttgtgtcacctctaaccggcaaa
tggatcgaccgatctggtgtcgtcaagccgatctttgcgggagcgcttttgatgacggct
ggagccgtgctcttaaccatcttttttatcaatgtccagaccatcggtaaaggcctcatt
ctgtcgctcttgggtataggctacggactgggcaatgtcgcgcttcaggcagcgatgctg
gaaacgagtccttccaacatggtaggaacgacttcaggcctgtttcaaacctgccgttac
ctaggatcgattttgtcttcggtgatccttggcattctttttggtaaagaaatcacggca
gcccattttgatatgatgggaatcattatgattatagcgggcggagcaagcctgttaatg
gctgtgagatttgctgcattaatgaaaactgcatcttaa

DBGET integrated database retrieval system