KEGG   Bacillus subtilis subsp. subtilis 168: BSU36490
Entry
BSU36490          CDS       T00010                                 

Gene name
ywoC
Definition
(RefSeq) isochorismatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Isochorismatase
Other DBs
NCBI-GeneID: 936934
NCBI-ProteinID: NP_391530
Pasteur: BG12490
BSORF: BG12490
UniProt: P94573 A0A6M3ZHW2
Position
complement(3755291..3755860)
AA seq 189 aa
MMNTLNIDFQKTALVIIDLQKGIVPIDQSGQVVPNAKKLVDEFRKHNGFISFVNVAFHDG
ADALKPQTDEPAQGGSGEMPADWAEFVPEIGVQDGDYTVTKRQWGAFFGTDLDLQLRRRG
IDTIVLCGIATNIGVESTAREAFQLGYQQIFITDAMSTFSDEEHEATLRFIFPRIGKSRT
TEEFLEQVK
NT seq 570 nt   +upstreamnt  +downstreamnt
atgatgaatacactcaacattgattttcaaaaaacagcattggttatcattgatttacaa
aagggaattgtgccgattgatcaaagcggccaggttgtcccgaacgcgaaaaagctcgta
gatgaatttcggaaacataacgggttcatcagctttgtaaatgtagcctttcatgatgga
gcggacgccctgaagccgcaaacggatgagcctgcgcagggaggttcaggggaaatgccg
gcggactgggccgaatttgttccggaaatcggtgtgcaggatggcgattatactgtgaca
aaacggcaatggggtgctttttttggcacagatttagacttgcagctgagacgtcgcggc
attgatacgattgtattgtgcggcatcgcaacgaatatcggggtggaaagcacagcacgg
gaggcatttcagcttggctatcagcagatttttattacagatgccatgtccacatttagc
gatgaagagcatgaagccacactgcgctttattttcccgagaatcggtaaatcgcggaca
acggaagagtttctggaacaagtgaaatga

DBGET integrated database retrieval system