KEGG   Bacillus subtilis subsp. subtilis 168: BSU36500
Entry
BSU36500          CDS       T00010                                 

Symbol
ywoB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DoxX_2 DoxX
Other DBs
NCBI-GeneID: 936938
NCBI-ProteinID: NP_391531
Pasteur: BG12489
BSORF: BG12489
UniProt: P94572 A0A6M3ZGS9
Position
complement(3756044..3756508)
AA seq 154 aa
MMNKGGRLRKAVRKSIPATFRLFLAFNFFVYGLAKVVIGQFGEVTPEIEAAAGKGFTIAW
TFFGYSHVYELFIGFGEILAAVLLLIPRTAALGAVIFMPIIVNIVLINYCFDIGVQDLST
ILMVMCLILLWMDRRKFMGIFRQEPIDSRQVMKR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgatgaataaaggcggcaggctgaggaaagcggtacgcaagtcgattcccgcgacgttc
cgattgtttttagcctttaattttttcgtgtacggtctggcgaaagtggtaattggccag
tttggcgaggtgacgcctgaaatcgaggcggctgccgggaaggggtttacgatcgcgtgg
acatttttcggttattctcatgtctatgaactgtttataggttttggtgaaatcctggca
gctgttttattactgattccgcgaacggctgcattaggggcggttatttttatgcccatt
attgtgaacatcgtcttgattaactattgttttgatattggcgtgcaggatcttagcacg
atattaatggttatgtgtcttatcctgctttggatggaccgccgcaaattcatgggcatt
ttcaggcaggaaccgatagacagcaggcaggtgatgaagcgatga

DBGET integrated database retrieval system