KEGG   Bacillus subtilis subsp. subtilis 168: BSU36510
Entry
BSU36510          CDS       T00010                                 

Symbol
amtB
Name
(RefSeq) ammonium transporter NrgA
  KO
K03320  ammonium transporter, Amt family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36510 (amtB)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU36510 (amtB)
SSDB
Motif
Pfam: Ammonium_transp DUF4133
Other DBs
NCBI-GeneID: 936933
NCBI-ProteinID: NP_391532
Pasteur: BG10869
BSORF: BG10869
UniProt: Q07429 A0A6M4JPX4
Position
3756790..3758004
AA seq 404 aa
MQMGDTVFMFFCALLVWLMTPGLALFYGGMVKSKNVLSTAMHSFSSIAIVSIVWVLFGYT
LAFAPGNSIIGGLEWAGLKGVGFDPGDYSDTIPHSLFMMFQMTFAVLTTAIISGAFAERM
RFGAFLLFSVLWASLVYTPVAHWVWGGGWIGQLGALDFAGGNVVHISSGVAGLVLAIVLG
KRKDGTASSPHNLIYTFLGGALIWFGWFGFNVGSALTLDGVAMYAFINTNTAAAAGIAGW
ILVEWIINKKPTMLGAVSGAIAGLVAITPAAGFVTPFASIIIGIIGGAVCFWGVFSLKKK
FGYDDALDAFGLHGIGGTWGGIATGLFATTSVNSAGADGLFYGDASLIWKQIVAIAATYV
FVFIVTFVIIKIVSLFLPLRATEEEESLGLDLTMHGEKAYQDSM
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcaaatgggcgatacagtttttatgttcttttgcgctttactcgtgtggctgatgacc
ccgggattagcgttattttatggaggaatggtaaagagcaaaaatgtgctgagcactgcc
atgcacagtttctcttccattgccatcgtttccatcgtttgggtgctgttcggatataca
cttgccttcgcaccaggcaattcaatcatcggcgggctggagtgggcaggcctcaaaggg
gtcggatttgatccgggagattacagcgataccatcccccactcgttatttatgatgttc
caaatgacgttcgccgttctgactacagcgattatttccggggctttcgcagagcggatg
cgattcggcgcttttcttttattctcggttttatgggcctctttggtttacacacccgta
gcgcactgggtatggggcggcggctggatcggccagcttggagcgctcgatttcgctggc
ggcaatgttgttcatatttcctccggggtggcaggacttgttcttgccattgtgctcggc
aaacggaaagacggtacagcgtcttctccgcataacctcatttacaccttcttaggagga
gctttgatttggttcggctggttcggctttaacgtcggcagcgcattgaccttagatggt
gtggccatgtacgcgttcatcaacacaaacaccgcggctgcagccgggatcgccggctgg
atcttagtagaatggatcattaacaaaaaaccgacaatgctcggagcggtatctggggca
atcgccgggcttgtcgccattacgccggctgccggatttgtcacaccgttcgcttccatt
attatcggcatcatcggcggagctgtttgtttctggggagtattctcgcttaaaaagaaa
ttcggatacgacgacgcgcttgacgcctttggcctgcacgggatcggcggcacatggggc
ggaatcgcaacaggattattcgcaacaacctctgttaactcagcgggcgcagatgggtta
ttttacggtgatgcaagcttaatctggaaacaaatcgtcgccatcgccgccacttatgtt
tttgtatttattgtcactttcgttattattaaaattgtaagcctcttccttccccttcgc
gcaactgaagaagaagagtcacttgggcttgacttaacgatgcacggggaaaaagcatat
caagattctatgtga

DBGET integrated database retrieval system