KEGG   Bacillus subtilis subsp. subtilis 168: BSU36520
Entry
BSU36520          CDS       T00010                                 

Symbol
glnK
Name
(RefSeq) nitrogen regulatory PII-like protein
  KO
K04751  nitrogen regulatory protein P-II 1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU36520 (glnK)
SSDB
Motif
Pfam: P-II
Other DBs
NCBI-GeneID: 936937
NCBI-ProteinID: NP_391533
Pasteur: BG10870
BSORF: BG10870
UniProt: Q07428 A0A6M3ZHC0
Structure
PDB: 
4R25 4RX6

Position
3758016..3758366
AA seq 116 aa
MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVY
ERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
NT seq 351 nt   +upstreamnt  +downstreamnt
atgagcggtcaaatgttcaaggtagaaattgtaacgcgtccggcaaattttgaaaagctg
aagcaggaactcggaaaaatcggagtgacctctctgactttctccaatgtacacggctgc
ggccttcaaaaagcacatacggagctctatcgaggggtaaaaatagaaagcaatgtatac
gagcgtttaaaaatagaaattgtggtcagcaaggttcctgttgatcaagtgacagagacc
gctaaaagggtgctgaaaacgggatcaccaggtgacggtaaaatatttgtctatgaaatc
agcaatacgatcaacatccgcacaggcgaagaaggacctgaagcactttaa

DBGET integrated database retrieval system