KEGG   Bacillus subtilis subsp. subtilis 168: BSU36530
Entry
BSU36530          CDS       T00010                                 

Symbol
bcrC
Name
(RefSeq) undecaprenyl-diphosphatase BcrC
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU36530 (bcrC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU36530 (bcrC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     BSU36530 (bcrC)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Diphosphatase
   BSU36530 (bcrC)
SSDB
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Other DBs
NCBI-GeneID: 936946
NCBI-ProteinID: NP_391534
Pasteur: BG12488
BSORF: BG12488
UniProt: P94571 A0A6M3ZGU1
Position
3758547..3759128
AA seq 193 aa
MNYEIFKAIHGLSHHNSVLDSIMVFITEYAIVAYALILLAIWLFGNTQSRKHVLYAGITG
IAGLVINYLITLVYFEPRPFVAHTVHTLIPHAADASFPSDHTTGALAISIAMLFRNRKIG
WPLVIFGLLTGFSRIWVGHHYPVDVLGSLVVAIIIGFLFFRFSDLLRPFVDLVVRIYEAI
INKLTKKPTDQNF
NT seq 582 nt   +upstreamnt  +downstreamnt
ttgaactacgaaatttttaaagcaatccatggactatctcatcacaattcagttctcgat
tccattatggtcttcatcacggaatatgccattgtcgcctatgcccttatcctattggca
atctggctgtttgggaacacacaaagcagaaaacatgtgctatacgcaggcatcacagga
attgcaggccttgtgatcaactatttgattacgcttgtttatttcgaaccgcgcccgttc
gttgcgcatacagtgcatacactgattccgcatgctgcggatgcttcatttccaagtgac
catacgacaggtgcattagcgatttctattgcgatgcttttcagaaaccgcaaaatcggc
tggccgcttgtcatttttgggcttttgacaggcttttcgagaatttgggtgggacatcac
tatccggtagatgtattgggcagcctcgttgtcgccatcattatcgggttccttttcttt
agattttcagatctgcttcgcccgttcgtcgatttggtcgtgaggatctacgaagccatt
atcaataaactgacgaaaaaaccaaccgatcaaaatttctaa

DBGET integrated database retrieval system