KEGG   Bacillus subtilis subsp. subtilis 168: BSU36540
Entry
BSU36540          CDS       T00010                                 

Symbol
ywnJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: VanZ Virul_fac_BrkB DUF2809
Other DBs
NCBI-GeneID: 936936
NCBI-ProteinID: NP_391535
Pasteur: BG12487
BSORF: BG12487
UniProt: P71045 A0A6M4JPY1
Position
complement(3759169..3759591)
AA seq 140 aa
MNRLLLAGWIFFILLSVCTESFSGMVVSQTVAFHFQPHPDLSQFLVMDFTELTVPEAFIQ
KIGHAFSFFVLTYLLWKQRGSIRSAAAGSFAFAFFTEVLQLFFSRNGCIRDVLIDAVGIG
LFYGLYVLAKRRKQEMYEKY
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaaccgcctattgctcgcaggctggatcttttttatcctgctttctgtctgtacggaa
agcttcagcggcatggtcgtatcgcaaacggtggcttttcattttcagccgcaccctgat
ctgtctcaatttttagttatggattttactgagcttactgtacctgaagcgtttattcaa
aaaatcggacacgcgttttccttctttgtgctgacatatttgctgtggaaacagcggggc
agcataagatcagctgcagccggctcatttgcgtttgcttttttcacagaagttcttcag
ctcttcttcagcaggaatggttgtatccgggatgtgctcatcgatgctgttggaattggg
ttgttttatggtttatatgtgttggcgaagcgaagaaaacaagagatgtatgagaaatat
taa

DBGET integrated database retrieval system