KEGG   Bacillus subtilis subsp. subtilis 168: BSU36550Help
Entry
BSU36550          CDS       T00010                                 

Gene name
spoIIQ
Definition
(RefSeq) stage II sporulation protein Q
  KO
K06386  stage II sporulation protein Q
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU36550 (spoIIQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 RnfC_N
Motif
Other DBs
NCBI-GeneID: 936951
NCBI-ProteinID: NP_391536
Pasteur: BG11978
BSORF: BG11978
UniProt: P71044
Structure
PDB: 

Position
complement(3759702..3760553)
Genome map
AA seq 283 aa AA seqDB search
MREEEKKTSQVKKLQQFFRKRWVFPAIYLVSAAVILTAVLWYQSVSNDEVKDQLADNGGN
SAYDNNDDAVEVGKSMENVAMPVVDSENVSVVKKFYETDAAKEEKEAALVTYNNTYSLSK
GIDLAEKDGKDFDVSASLSGTVVKAEKDPVLGYVVEVEHADGLSTVYQSLSEVSVEQGDK
VKQNQVIGKSGKNLYSEDSGNHVHFEIRKDGVAMNPLNFMDKPVSSIEKAATQETEESIQ
QSSEKKDGSTEKGTEEKSGEKKDDSTDKSGSKESSTTEDTEQS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggaagaaaagaaaacttctcaagtcaaaaaacttcagcagttttttcgtaaa
cgctgggtgttccctgcaatttacttagtcagtgcggccgtcattttaacagctgtcctt
tggtatcaatcagtatcaaatgatgaggtaaaggatcagttggctgataacggcggaaac
tccgcatatgacaacaacgacgatgcagttgaagtaggaaagtcaatggaaaatgtcgca
atgccggttgttgattctgaaaacgtttctgttgtgaaaaagttctatgaaaccgatgcc
gcaaaagaagagaaagaagcagcactcgttacctataataacacgtacagcctaagcaaa
ggaattgacttagctgagaaagacggaaaagatttcgatgtctctgcttctctgagcggt
acggttgttaaagctgaaaaagatccagtgctgggatatgttgtggaagtagaacatgcc
gacggtttatcgactgtgtatcaatctctttccgaagtaagcgtagagcaaggtgacaaa
gtaaaacaaaatcaagtgatcggaaaatctggcaagaacctttacagtgaagacagcgga
aaccacgtgcactttgaaatccgtaaagatggggttgcaatgaatccgttaaactttatg
gacaaaccagtttcttctattgaaaaagctgccacccaagaaacagaagaatccattcag
caatcttccgagaaaaaggacggatcaactgaaaaaggaacagaagaaaaatccggtgag
aaaaaggatgattcaactgacaaatctggttctaaagaaagcagcacaacagaagacact
gaacagtcttaa

DBGET integrated database retrieval system